05-21-1931ENTERPRISETHE w.4san<G1~on 00UN'l'Y'B
LARGESTPUBLICATION
mmrrs 'masaws-n¢pra~»|
)
WASHINGTON COUNTY,NEBRASKABLAlR'S LEADING NEWSPAPER
THE OFFICIAL PAPER OF WASHINGTON COUNTY,NEBRASKA
Pnhlinhad Wzekly by John A.RhocdsVOLUMEXXXVsur»¢n»¢m Price. 51.50 per Yw Slnde Cow.s¢
hvnt\oG¢nll|8|otdlh||nlk»-»BLAIR,NEBRASKA,MAY 21,1931
;.\{ Stnte ~
18WnhhmhlGuam.
KENNARD CHURCHES
PLANNING SERVICE
4
an
a
a
g
n
c
a
4
4
o
and cmdo.The opinions of
the great majority of the
voters of the state were
thrust aside and one man
assumed the right to use the
most deadly weapon in the
hands of a writer which is
ridicule to belittle their
choice and handicap the cf
forts of a man who has at
.:|:
l\
Q
I
$
a
m
l
rr
|
a
as
¢¢ a G
|
es a e e o~
4:
»
s
l
up for the rights of his con
stituency and the common
people.
nanoasnaooaon
a
I
1:
Q
a~~o
0
u
n
s
U
l:.l .a:I
article.Holding up Senator
Norris to ridicule itsucceed
ed far beyond the intention
of the writer and made the
..|g .
0
an
a
1
|o of an invitationfrom um °
Chamber of Commerce or *
*Fremonttobeprenent ata.
Il
I
¢
a
as
0
0
o
4
0
»
l
ll
»
evming in Fremont to Edi»
bor Ryckman of the Fremont
Tribune for his success in
winning the Pulitzer prize
which is awarded yearly for
the best editorial written in
the nation during the year.This editorial in question
proved to be a scathing reviewofthecareerofGo.W.Norris from the anglecof
one who was opposed quhim.Insofar as we areconcernedwefailtoseeanyconstructivegoodthatcould
4
l
n
s
a
an
0
Q
a
ur
4
o
ugl
:I
#nanoCouncil To PurchaseNew
Boiler For LightPlant
»M 1 r cw Q ¢nFlNAL M.A.c.~egular eel ng o \y unConsiders Many Important Moves MEETING IOR Y
Will Purchase New Boiler for The Monday Afternoon Club
URN Plant held file final meeting ol the yearlonMay18atthehomeofMrs.
~Ewan oUrLsr is PnoaLsM E.c.Hunt..|There was no topic nssigned for
lhe afternoon.The members nnsweredmilcallbypresentingPlen[or Taxpayers Qi Suggests suggestilo for next yeurs pro~Plan for Paying for Pool lgram.Following the roll cdl elecltionofofficerswokplncewhich
ily Treasurer Robertson Makes
A good nttcndunee of interested
~nloolccrs was present at the
. ectlng of the city council which
~ns held lust Tuesday evening
nd n number of propositions of
mporinnce to the :ity were con~idered.
The sewer outlet which is =E
enacc to the health of the comunitywhereitislocatedmg~riefly discussed and then the pur.hnsing of the swimming pooluipmehtwastakenupundthe
resulted as follows:presidentMrs.E.C.Hunt;vicepresident
Mrs.W.W.Wilkinson;secretary
trensurer Mrs.Fred Nernetz.
Progrnm Committee for 1932:Mrs.
A. J.Hargett Mrs. V.Bellows and
Miss Katherine Healy.
A committee consisting of Mn.
Com Iludgerow Miss Blanche Hill
and Mrs.Nemetz served refreslfh
ments oi Dixie:ice cream and assortedcakes.
Tho remainder of the afternoonommitteeinchargewasgivenwas spent in visiting and admiring~uthonty to f Fl the required the Hunt e which has recentlyumbcrofbathingsuits.lhcen remade d making it the most
The delinquent taxes were talked
~r and the council employed~ttomey Lundt to collect these
~nd if necessary advertise the
roperties for sole at public auc
modern home in the city Mrs.
Hunt very kindly escorted the
ladies over the house showing tho
many improvements und new
uipment.ion.This some plan was adoptedl The post year has been a plen~me years buck and while the nnt and profitable one for the
properties did not sell for thoClub.Mrs.Lorraine Mummert
ount of the tax yet nround has been the president for the past
~1700 was brought in in this wny.The paying for the swimming
two years and has served faith
fully and well.
exercises at the school house onThursdaynightwhenullthefam~
ilies in the district except two were
present.
.Q...
C.C.Gnyhnrt and Rob Whit#
wonh,two of the pipe line gangwhohavebeenlayingpipesfor
natural gas which is being brought
ummmmn_
A raid on the Floyd Green
home on lam Saturday night was
....|g
mer teacher at Technical Highschool, who is teaching in Honolulu
lhis yenr.She also visited in To
klo and Kobe from where herpartysailedlorSwghal.Before
going m Calcutta Dr.Fairchild
spent some time in Hongkong and
Singapore.A letter from the Omahxm de
scribing her work and travels was
4|
4
I
4
s
as
s
a
0
l
any time step to the phope
and instant service is provided.In fact Blair buai
ness needs no assistance
from outside finns.I.ets
do business with Blair pco~ple and keep our money dr
culating in Blair business
channels.
||llllClI1gl|
I
a
4
4
s
4:
Q
|
an
1|
OfficersMake
BoozeRaid
»»~»...|..»
PnorEcmw :0 :1:S¢hool'sCut
room full of men engaged in A
ing of the Nebraska Assodntlun
nf Medical Women Tuesday eveningat the Ponmnelle.I ..
|1|||.|
County Judge I. C.Eller
||
Full of Men Enjoying Beer.
The Parties Were Placed Under
Arrest 1
s
I I||
C Q 0
\
\A
».~Qfw ;
..~.
....f
* mxlcingadvanc~w B~~\
s
s
u
a
o
s
a
c
z
n
c
s
n0
s
a
secure their demlnz bud
neu.(hrds have been dis
tributed thtnixghuut thetawn
which when left in the window is a signal for the drl~
ver fo awp and pick upclotheslorcleaning.We
wish lo remark that while
we have no fight on theFremontconcemthatBlair
has A cleaning establish
ment that does work equalto the best.This establish
ment is owned and operatedbyBlairpeoplewhospendtlelrmoneyinBlairand
a
0
|I
I
0C
o
o
ln
s
n
s
a
|
s
lauclooooaalocoo
ber of years in Kennard whereshe is well known.She in a dl
ier ol Ralph Fairchild, teacher ofthiscounty.
PipeLine
WorkmenFined
Charged with Being Drunk and
Disorderly Results in $10 and
'|.
||.
PROGRAM IS HELD
AT MANEY SCHOOL
The Maney school hcid its pro
l
a
O
4
~ople.Better still the
housewife does not need to
wdt for a driver to call at
O
n
0
n
Fight
FORMER OOUNTIAN
srunlm ABROAD
Dr.Nora M.Fairchild who left
Omaha some time ago for scmisa
on the Pacific and a hour ol the
continent is studying #Ye surgeryand doing observation work ln Cal
cutta and other dties of India accordingforwardreceivedin0ma<ha by members of the NebraskaAssociationof Medical Women.
The Calcutta School of MedlcinoandtheSchoolatTropicalMedicinehavegreatlyinterestedDr.Fairchild who watched twenty
..|I 5 r.school.
On her way to India Dr.FairchildstoppedatHonoluluwheres
*\2 111~~1 aaéfr 0 =>z~~~~;~
~~»3%~J iif;.;|.=K.s=a1
A.sml&~"=v»~»|5**5@?"""ii"
»==.1 _~é =... _:_~}~.*=Eq;..*F
__~~~b \g\~~
~La 1 ~T 1~n {f §.{....T...Bf ¢as ~.i \\~~¢=.f§j
~...x »
~gg .~uf .~~.~g;
W ~~..§;~f.t+ff
~f ~~;:;;;..»=»If
To
502 State Bank:(nlribute Fm#
IREFUSE ro PAY Assnssmnwrs
The Bank Guaranty Law is not[yet settled as is evidenced byan|action wherein five hundred and
:two banks naw have contributed 60
Lh§fux1d to bent the final settle
ment fund uct in the sunrnnv litl~
gation according to the Nebruln
Bankers association.Seven banks
refused some hlving pnid theirdraflaandothersexpressingdilnpprovnloltheassociation!actionmxordingtothoorganizn~|tiann bulletin.Sixtytwo hankx»have not taken my action.
|The action will be watched bymanyover the state and both do!Podfors aiui bankers willarucious-
The Kennard hhzh school mm..mencement exercikgg ~liek .at the Methodist church ut. 8 ;:i.m.Thursday.Chancellor I.B.sumclxengasc ol the Nebraska Wesleyanunlverdtyat Lincoln, will gintheaddresstotheglansofeightgirlsandthesevenboysofthe
eighth grade who will receive the!!
dplomu at this time.
The lchoola will close Flidnywithapimicdinnermtheidea!
nite plan by \rhichf.his could boi"s1xry»11ve 11 oclock will be a memorial ser ii§§. E§i5eZn ~
~E vige conducted by the pastor Rev.arrest and on Monday they wereInnannomnxrE.P.B00he1.The evenimz ser arrninrned befora .IndiraCh.a.mben.=
on a charge or cmmkenness.
Monday they were arraigned I
fore Judge Eller and plead gui
un =...ww W ¢.Wy um ¢wm»e~be_ directed by the teacher Miss Alice
lty French of Kennard.Mn.Delbert
no Fowler gave the commencementwaddressthenpresentedthethree
The Bldr public schools ue cifi
dally dosing on Friday.On Fri
day mvmlnx at 9 oc.lock the report cards and promotion cards will
'3,'1':'i3.'ff*f_**i?.f1P°5=;-F?i*sfTf2°1"~fIBLAIRITESLmvlwueru.ion was present ana 1n uatalkhe urged the council to use """nusxun
ilu;money now ln the light fund h_to pay the debt and made a plea mx_ ;Thn gg and i£?§L fff=that the laxes be not increased ......L.»....1m.|.....a..\.....»..:».~
vices will be th f th " Ian ""f°"" -"-'-v "`""¢`_"}i."° me curse ana were "'E'°"1
........................Rev.H.Nielsen ol Blair will
hold services at the Kennard Lu
tJ1ers.n church next Sunday at 8
p. m.There will be Sunday school
seadons zt10 s.ml at both of
these churches that day.
Mr. and Mrs. E. G. Hansen :ment
...ae or ...=_.~..e..~..V.liquor and was Gm $100 hut her
Hue was paid.lmBothpartieswerewiththeposaesdouofmaahand
on this charge wen held over to
appear in district court in the
amount 01 $500 bonds which werer.....¢.\..a ..A nm .»..»\{\..»»+v
s1s.4s.
NEW UNIFORMSFOR
A.L.I IRING SQUAD
The American Legion tiringsquadwillappearalldresseduponMemorialDaylnconsequence
graduates wun Lhelr mplumas.Misses Ruth Andreaaen and Cleo
French seniors of the KennardhighschoolgaveacomicalskitASuiterBoldthat caused much
merriment among the npecuwn.The school picnic was held on Fri
day when every family in the
be dlstrlbuted to the grades At
1:16 the final high school convo~cation will take place in the Senior
hlgh auditorium.A ml pxugnmwillbegivenwhichwillinclude
music speeches by high school abudantn and faculty members andthe
presentation ol the letter Awards
pun;wr lu wlw care KDaweua.The baodaureaos sermon mthshighschoolgraduateswasdall
vered by Rev. E.P.Bonher at tha
Methodist church at B |>.m.Slmdaynight.He chose for his tan2Tim.2:15 and gave a splendidandhgpfqtalkwhichwasen
ta t }¥JB\¢<Sl.\.\n;1. Il C\u|ci:ru¢|;|.u.|vn;uu
Zmmfs 3..~§Z §§Tf§»§lien i by automobilg for U.inn so Bos1
n..._._.._..__________A..ton Massachusetts where theyul
p
'::'i:§":_::':'wcru uulllus "'|wn|vm:Hn.uenum-ue mlnyumlruxei.75|Aiden and 3 bmther vdwm llu1.f§If§.lf...§§?f1f21I hll not lem for nmu.fo uullbml unu will DtlllmuuJensendlatedthtch They are nnddpating a de1ig}}t~ec a su a move ful mp pawns as they willwoulirnenntheeventualsllingofhgmterrigoand
eugryfhl¥TF_R?f??d Smh m oder manv new scenes.They will havo
1 _r |\lLlunuG\||nuu.unc;the weekend visiting at the S.G.The officers ara g;
Cram home in Fremont.lated on their work.
`§¢";.,;$ea:ol a move nm the part of the
legion boys to secure fourteen ob
new Nebraska legionaire uni
forms for their members.
This will be the first appearance
ma wyux n uw uvngmgluuu.3"msmct was presentiiur
Zginthtz §{;";{2""pmgmm is A mga quutet Maura George
ma."mms the graduating Hedelund Lester Krrmberg Frm!
._____.mmf n 4.1 fan..............\.~Dyer:and Earle Jenkins lm!!x°fi'f,ff"§§{°a"f;'w"b;'§f;f Qfgfuf a wlmael-ful mghwafu travel nom:1-zconosmcs
chased for the plum..This we :::;f:;J expexienoe mu be County Famer sri
understand will take around $26~000 and né there is around $30 Theybgxpect to be gone unul F d D d The Home EcxmmunointhefundthiswoulddeS*L _?.....Ollll Ea ment had their style
Wine Line ls :"::.';:'..".:::..,.£."";;é"'§l'\."f lnumber of selections durlnz theImg8uuu.|o:.1.u.rrul..n.n..nwllldh an u...n.....|....fa ..1.tus WW
mics departshowinthe
igh school on
DNKYMD was
ol mdformg in the locd orderand
they will be worn on dl specialpatrioticowasions.They are niftylookingof dark blue with gold 1mm needs no introduction to Earle Jenkins
buttons._Blair people as he was a very el-
The wforms will be pand for byln.......»_ n..:_nm..L_ ¢_¢._ Hclent city superintendent here OBSERVES MTH
r'_..._-.,Dean of the Departmmt ol Edu- .,.....~.b...................°.....
aupn Q!ynyne sure College wan we n eautdth ;;__;K ac
Nearly ~bechespeahfof ihe évening.Mr;wmv on e n Y W*
plete the fund for the presenttime.
The reading and allowing of the
The 1:
happy s
smerpnse mane;rnel a Music Room of the Eumrner and pleasant tnp.hast Thursday.The
SALE OF IIARTINGTON Had Been Missed for SeveralPLANTISCONFIRMED
The report that the Interstate Him
Power company has acquired controlof the Hnrtington Electric SHOT THROUGH TlIE HEAD
opened with a pamant of "Girls of
Today" showing costumes worn at
different times now and those
worn ln the past.After the styleshowlhefollowingprogramwas
gwen:piano solo Kathryn Sas;...|=......m_».__._..._.»__
thcmembers and the Legion with
the exception of four which have
been donated by Reed 0I{|.nlonJ.E Campbell Voe Searing and
Clarence King.
mm.w ue ru mmf vy rnuuyNight.The Line is Being Run to
Arllngion.Undecided as to Time
of Connecting with Blair
nsrolgr SERVICE IS CHEAPER
before going to Wayne.We aremrsthatMr.Hahn will brihg areadmessagetotheBmyeigmmembersof the Blair Senior class.
MISS MEAD smms LONG
henna ann umm Annrvsnsmx
Mrs.Greta Chrinemen,who
ms her home with Mr.md Mn.
Vi r Runluuen of east Collar:
street celebrated her eighty
bills completed the work of the
meeting
.I umunm.amuu lmniqu 151
rne annual Junlort5en1or nan Li ht conquet and program were held inthg mg dailyhiirh school auditorium last.Fridau ...
n l l lreuuuur.rms me uream.mar|PA|m||.Numl il:IL 2 J J \Au uusxun Iolll|»I1 D!
day H
of this ary.an extane
\ru1 pnnxvennry ns:rn~y 15 when friends amsIbest wishes and eongntf
mpany as connrrnea ny ..Igaret iiaher;barltozfa solo Betty Hum.fglfg CONTEST The laying of the pipe line.Pff.of T€.fZ f¥_fff_.3I1?f§f_¥fff Q_fl1§|Moau:readilur.Jame.Elly Maria which will bring natural :ras into Miss Ethel Meadclerkam:exoxuclo registerevening.The festivities openedwithalinefourcoursedinnerser deeg;of Cedar ;§;>
~ved by the ladies ot the Methodist £0 .B WYE a 1 o e o
ch Follo .the dinne an mnglble propeny was emecuted hY
_____;_______L_the local company C0 the Inher
2Z»Z$vZ\§?i.Z§2T ¢.l$$§»§§21»Cg Lama.In B contest based on w great.miles north of the German hall in The last pm msgs l K»My eat.eflicleney in P\| m8»the
the southern part of Lhe count Dear little Home Ee Gvwn.At street intersections at the yahoo]on Wednesda M zouh y the close each girl modeld the hou uw ml mbgfgwn
Y.ay ..___.__._.___ .______1 ...P.nu ..:Bldr is nearly completed and un who is sojourning ln Califomla ulationl.less unseen accidents happen the hae remembered the editor ol The ThoselinewillbeinBlairbyFddnyEnterprisebynmdlngacopyofthisoeclnightolthis week.Just when the the lang &nch Sun of the ln»gkw Ninn|.1|nnn ...cn L...a ........_4x.....I PhanAnn ;..x|on ...\.x..\.
w rnmnmhnnd hm nmudvnwerellr.md Mn.
elsen Mrs.Baamus Jof
Mn.Jem Clausen and
|Gorm Jenam.
following dxy her dumb
a.hrs Jensen .md lr.
excenmnw P!0Kram was glven.Rollund Bueklin played s pianosolo;Margaret Maher read Pink
Ice Cream;Frederick lKeglergave a bantone solo;Reed 0Hln
.___..__..
state Power company on Feb.29
1931 and a deed to the propertywasfiledonFeb. 2.On Feb.17themoi(gage for $75000 held bythe0mlAhATrustcompanyagainst
.Iurvuu mar me mano m nome :.awarded me nonor ox Dang mon..»§iQ£.§.§..ZZi..€.gf..ii.é.l3 nomlcs.These dresses were school sfflclenl.A a reward me patrolthat he was wins after a com dresses made of cotton sud they number two will bg mmd to Aplanter and when nothing had mused in cost price from 874: m beefsteak md by patrol number1.
been heard from him for several "EL .._,._ _.._..,P*=9,'°='"¢:*d°~ .'""=i.f@°°*.?"""°
xml,
dedded ufuture.
A line
main u..
............=w»...¢......W U...........ny...W .....w nmnsenhasnotdefinitelybeenpresentsitseighthannualedtionMn.mlntitwillbe Ln th¢neu aetiingforth theprogreu nad de~Onthe_.vdopment of Long Beach the P .ter Mxlendingof!from 7h*lY Ilelhm ol Tekamnh.mms downisu1sobeingmntoAr~Tl1e8unoon|dsfAolB0p|~gu¢0 betwhgch ~hich is n distalnm ofover 8 columns mud in filled with all m
§f..foxzhex.was a P
~at th¢cmssing 0f\hit goes in make up L pmgresdvu
FP gxver ~¥:¥\E ¥lP P€The ~:tus ~nlnun ln:~r~nur
1.uu SavE a IEW rl:m8.ri£B lor InB\the Hartington plant Wag yglggged.Tumor dass;the response was
nuzu gun nan men w Benecv ws held next |pugmay may Zl..hours his family became alarmed pattern and mntednl ben ndwd Members of uw vdnnlng
patrolandasearchwumlde.Hiacar.........._lingwn wl
dx miles
the Elkho
Oon, adom
given by Stanley Jensen,presidento!the Senior class.Other very ANNUAL POPP
interesting numbers were.a solo
__
Y DAY was found where he had driven gg "°Z°nIi°§i°..",,°"2§\3¢f"°dren
ON SATURDAY into the grove and his body withAbulletholeintheheadwaslegionAuxiliaryfoundon the ground.In hispocket|ATTEND STATE
mv will he held in a bnttl e of strvclmlne was found \CONVENTIONS
are:Donxld Nemetz Captain;ue#
roy Bucklln.I.leutenant»RaymondWolffJackMaherEarlWalntlm
Edtln Olson Dole Bnunbsozh
John Goodwin Herbert Kultermnn
me une or suamen Di|:resin |whem there was a virtually barI """"
being nm under the river.Thisin|precautionary meuure.At¢he place where these plpen nmunderthex-iver¢hem'amia680
ren ~°»;8;-=;wQ"';'§ ma #_-3 The pina p1-pu, ol lm.cu-1and where there wu but a tiny trade Held wsu xwla one °'md'.resort mmm of su suuln in 1890. Pf=P"1f=f '°°"!!"9*W "°*h°'*"*~
number By Margaret Allen en The Am rg _titled I.ets Be Friend1y;a. duet m Pegg;
number =>t=@ StreeEUrc1unsf Blair Saturday I and Geo.McCormick.M."on wamlnma1ne11ad'dé§{£i§"£a1£é}fma;£h.."éT;I¢fF»"m.."E~.".§f|§}"`a{meuzeyCharlotte
by Frances Siert andlhgmifhm+»r¢nt Hz..unialn rN....|......A n:..1.I ~~"church next Mvlldly evming myMEfeet wide.Long Beach, now a g metro~COUNTY BALL GA S nother \nw lc; men are laying polls of more than 14 ,ooo, il not 53,3 :f:":_fll;°nv|t°dhi°h tha
.gnek a ne into Oak d and will also only a city of comid Ie stature~Illll.I i < §1£l.§.I.§§§=<1»f»».=. connect with Tekamah Craig and but one of many sided .and sym:nil Mead has .hL:dh:t;hm5 to 2_ Y est goue This will be a ieallmeti~ical development./2____mZ_{_fff X __~
_ff
.......\|n »||unD mcuua Luyaul uuu nuA§rH]Ht@g_~<§.and E qunr|The Girl Reserves under the dl|County Attorney Mencke a.nclIhone of this cltv returned lastmth:selecnon DY Ulll1ll¢e =ilPP1=ll~|».»u...nf Hin nmznl nl .mnlnhmfr minm1.~|;....¢\\lnlnns\|||l*||nn|||l¢|:;..;;|..E..»_1ZI1Z1 .;;;;.|11
1:1
Eeld Fredek Kegler
......1........\...1 n......fl..2..L
m"n1.uunvn j I §""1r:\l v gmu;;;.;:;"vuu\lnlvu "nav uuuunxvllvul luulluly UYCRIIIR ITUU1 lIIB BILE_Ithe ihxxmliary Isdles in the Bale oflan§advmsed that an undertake:beponvention of the Pythian Sisters»»u.mm\.5»| mm nuy \.,|m=wu»un.Iwpnies 4 ggllgd at once and the body was aMissPemaHutchinson, who is The committee for Poppy Day is brought to Blair.The reports ue Ysponsor1 r the Junior class de Mn c.E.McComb Mrs.J.E.that the deceased had been dis v\serves great credit for thg success Campbell Mn.J.H.Bowman pondent for several days and was
ndK
............»====l1 uays we vnu Fontanelle beat Blair 11 fa 1 luxury to mem Towns as no plant The paper is signiliant of the |xnurucwr ln mls city mnreek.1 the ol 1 mmm d IThey went as delegates from the The Fontmelle pxmher allowed i;in operahnn in any of them |f§§f§¥§T€gffwg;thes:ea;iertz;_gg so the mg uzumpxgi
faiflapbers and reported azwd lf::rh din The superintendent in dmrgemosst z Rimfm f ?~equationDI.IDIS eve nt..Mrs.Raymond I
mm...
iurr and Mrs. L. C. |apparently not his normalself.IEITOURISTS MOVING WEEE' poppies bought this you dr;: ¢lf,}§§L§nY,1"d;T&hf"°" W".""1%.$"i'idd Fellows home is located ~--_v§' I6'1I;f)t0 ~""2l'fi$ff ~~
Lwere made by the boys nt the Vet-at York and Miss Taylor visited c nrihy ° ""mag the IowaN b ka U hc tl.Twylsfs f={e Pesimuns m ¢{|ke erans' Hospital ut Lincoln.s.4cc.u.A\mEA'rE there also.She :reports there are §"'°HW '.'?}Z2 Pow"n..,...~...f 'ffm .-..§....J?1'
me nu gmnen we Juauy deservesmcoznldonna one of Gods nobleIFEMEMBEROP
NEBRASKA]Msoc1E'rY|"°'"'"-
aavnnlage or the warm weatheranduredaily seen with ears ladenwith camping equipment going all
ways of the compass.On last
Tuesday morning n sruP ofthreecanleftBlnirheadedfor
seventyfour egsdlma thirtysix unown vreex ;;x>osnNG ran rmcn um he Fiftysixth Annual Becca children as inmates of me home at Papio 1nmate sermon which was held ln present.The grounds conaist of Fimntanelle oSenateFile102whichwillbe~ihe high school auditorium last 160 acres and the place isdn fine B mr mu
zcomealawAugust2.will be a Sunday evening May mn was ~h»1>»Blur will P Y at Rose nexveryimportantlawinstabalizlmz.:....\..n...1.1 nan.....~..f~Simday and Brown Creek at Pon
efasa250
000
3
2
~ ¢£J2§'§&au'}li<¢;;;;'Z}"I1';adjusfments necessary without
charge to the consumer.
aoosnasuensnsssng0|W|§f1A€[\l.l\¥I!IAY a
The Enterprise edlwr has receivedanannouncementtramthe
Board ol Governors of The Neb
raskana Sodety that he has been
eletffed to life membership in the
CARD OF THANKS
Wewishlotakcthismeansot
thanking our friends and neighborsandtheBlairandKennnrdmf.n.m»m»¢.(nr tha muah.California with a full outfit for
camping.They were going bythewayof Portland and Seattle withLong Bench, California the ob}ective point.The trip will cover the
larger part of the summer.
NOTICE
the marketing conditions of gas in
Nebrnsla.The legal deputmmtso!the vuioua oil companies in
reading this law ue unanimous in
the decision that the posted priceat service stations must be strictlyadheredto and any company sell
ing for less than tha posted pricewillhevuiltvnfamisdemennnr
....U nw..... ..................of the Baptist church.He chose for lhe subject of his
sexman Men tor Men and this
sermon was closely related to life.Some of the qualities which youthshomld posse: are connge an¢hus~hsm sticktoibivaness stamina
and the spirit ol adventure.He...____........_..._.\L_..
JUNIOR MECHANICS 4 H own
Now there are twenty members
tanellé.Contributed.
lmnomn.SERVICE
belonging io the Junior Mahanics The union Memorial service Wm** Y » l =dR*Y bexlemsnuaci mu atelevefnHooksmaHymnSorensen joined oclock my ui Following isat the meeting at the Byron Beyd the program~Snndsy dmrnoon.Hvmn.=i.f..}|...tha Bn.nti!\L\
s0
ss
A
o
c
oO
.0 \|.\.||
4 Q
Few people realize the¢IlUI'moI1| amount ofmoney'?P1F°&'?°d.>'°°~t'Y ..f'°e=:fha
0
'I1
m
='°°'"'°.,,";,".,° Board °:;?°,:f',zz:f s 'aa»'2'=="-Is1r»»
~ton,pdk Nab., chairman;Atty the fire which destroyed om-burnc.L.mm,Lincoln, vice-clmir~ and ""'°'*°°°** our h°";»mm: Dr. H.Awbm White, Uni-l enn
zlwum mx m U1 U measumLw.Yeueflxismtax »~~~mn
§mu}\ted_w_§}4ooopo per o edbor.SOCLALFORECAST
day for the full 866 dnys of °|the yen.The mul ot this °omm nfmuss roivue.income for the year Q =r~rl=N1¥~nl:PARTMENT IThis is to notify the public umm ~ »Li»j§¢'{£5Jiuié.I am leaving- Blair on June Istand
uw wwary":Hum us ww vw Only three memberswexeabsent.den of empire.Athletic and constitution comIRev.Moraxfu address vu very mittee:wer;nzhosen.The firstpractical~timely.It wu great problem Identification and une Oflyappmcmtedby fhe hrs!cmwd wood;and Mehll was receivednnlsntandalsohv tlnn mnmhan L__L _.__.......
Invocation - - - mv. A. F.Newell
Male Qmrtef, "RememberedYet"G.L Dixon, Jno. Moore, C.R-
um,H. H.Brown
Scripture R»eading~Rev.I»J-Mohan
l
0
0
I
C
put ran w ;s2211o9m md
was from an average tax uf4ampergallonandyettherearethosewhowould
rae qyr tu to even higher
a
l
0
0
U
|..
The sdenoe classes held npen|
house In the laboratories Thurs
day afternoon at which time some
.of the work dune thi!year was
those lmowlng themselves indebted
lo me will please call and settletheaccomatbeforethattime.Alter that date my accounts willbeplacedinthehandsof an ab
tomey for collection.
ATTEND w.B. ¢_CONVENTION
Mrs.Elsie McBride Sfate Pred
dent of the w.R.c.wzompnniedbytwodelegawsMn.JennieOffenandMrs.Amdla Clausen of
uy one ana macusseu unuur01theSeniordns.the leadership at Merton Kuhr.
Th¢boyawi1lm»ke;nmilbox stNcmcsthenextmeeting.bo be held wi0I
_hge Chriatmam of Cumins Gt!Mugy old gqldxexfw who hpvv amrm .Ima 7.mme:Dixon.
Hymn mm ofour Futheraii |.G.........1\....ur n D¢nAnn
_.mwuu -mv.n.uyw............Hymn AmericaBanedctian- Rev.A.J.Hargett
Mr. and Mn.Frank Schafer Mr.
llld Mrs.Cul Schmidt Mn.Minn
Sthmidt mi Mr.md Mn.DavidHmnmertwanBinhfriend:of
the Ed Nntuia who :handed Lbs
u
|
O
I
O
0
o0
|
ra!es man at present.It in n certainty when onenapsloeondderthisvast
:mount of money mlling ln
daily thxr there ia no meerdiyof voting road bonds ornidnsthetu.In dumfromthisvanincome1:
judicious!!handled every
1
0
l
|
l
at
oQ
displayed.Rubbenmaldng food~
mm.the testing oi means and
a number of other experimentsweredemonstratedby tho students
A fiho aowd nhended the demon
ltrwon.
Ben Growdy Attended s school.funn -Q ln ¢~..n1mm. Int Wed-
193In0
3nofl.
Inn.Q
aas25
reg
s
7
M21
as
Ma_Y
o 1.
6
I3
zo27
ln.
5
I219
zo
...warh.l z9noZ3so
an
5I522
as
18lt Dr n.W Balljthe local ornnizatinn.were in at\
.NOTICE
The Pavement on (
tendance afthe Depirnmein ConventionheldatFremzmtMly19zo and 21.passedonuelyingingnveuthatne unmnrked.In order thatmess nmnrel portu.
Qcuax street may be shown the proper respect m OKLAHOIIAisdoudfaMr.andMrs.TomNonkovmd°n"emm..mdy¢_h,w 3_0 rnna beenmnde 5>1g_°f Au°f,_N°L,:f°___S"_f*!quest;dnt mukan ~be ~Atfamey Cluk 0Hmlon ki!an I
and on'smh'}}.1-£2jtractors.~h:of tractors using pa|ny_.furt}}er infringen r Mmunaluqnay for Shawnee, Oklnlmmllnimle 'pm in tm m m w m d w
bg..
...
f.S....&3 hdr honor at the
It Slmilv Tha
umm0f¢lmNw
C
4
sI
roaddmyoonleqvsneeviil mai _¢Tc !helhy2lMud mt13;~ma vhe by ma.;mghzywxel Alice Ty cmnmuu my m_¢m§§.;l....€
||||g¢.||||||..E.d~
.tbms'nm»m»whmh»wm|»»k»fw:budnenc¢m»mpuku|.rl.J.H.ia!enlt|.Haqqzcahun n¢umoepndunwuh\L mumweamna.annum-nada lm:
nmt
gwig M33 an law. L.w.| warm, wanted atmmm .....rv wu .~.~....=...nn united may MH!!I1¢Bowman phms Rnd 124.W.wa ox Ponce.1s1\|cu¢.Experience not mmmy.ionul|s|.|uvl.llll|¢1|||||¢_lfllllll l""(|IUUIQTIH COIN
Blair, Nebraska, May 21. 1981
a picnic dinner at noon and leecream.and cake in the ailemoon.
Misa Nomm Erhtenkzunp was u
week-end guest at the Chns Peter-
son home.Otto Bierman vu a
Sunday guest.Stanley Aqdreason spent Satur-day afternoon with Alum Larsen
and Kermeth Andreason spent the
g w at the Rudolph Andreason
ome.
5"-1° of the Iaran Layman £am~
y.Mr. And Mrs. T. K. Iverson andfjxildren and Mrs.Margnret. Iver-son and daughter, Pearl spent lastThnndayevening at the R. M.
Iverson home.Dr. and Mrs. Lloyd Kunkel andDr.Herman Hurdum o l Omahn,were Sunday dinner guesfa of Mr.
and Mrs. Fred Hurdum.Herman
i s a pmd i ng nle qd a y a a fh i s t wo
Mr. and Mn. Louie Grimm Sunday
aftarn0011-Mz.and M n .Mon-In Christen-
sen m d children visited Sunday
with the 11.M.Ivenan hmlly .The A.w .Cluke family wa nalso afternoon visitors thereMrs.Gmxlée Inughlin and
daughters of west of Hen-mm,
spent Saturday afternoon with
Mrs. Henry Beam.
having their last day pidc. Mon-day evening the graduates ol this
school were given A banmgt at the
Amon Anderson home.'ss Paul-
xenhueontraaedtoteachthehsw
er room of Uh Rose Hill schoolf o r n u f v w -Mra.Lfum Anderson and chil-dren of Tekamah, had Sunday din-
ner with her parents,Mr.and
Mn. George Morgan.
red cedar logs takm from t.behlllslano£her num, mounted on a fn-B11youth ol the old station and islhorse,matched the mall bag and ' 11'~`f1-§""`""K`P heated lbollf foI11 ~dll'*éCtl\f}f1lt*9r{ in Hun nnvl nfnflnn.Rn tha N._ _- - - " ¢- " " \ 1 f \ . |I r v i n l v R Q U U v q u n v l v " \e a s t o f F o r t M c P h e r s o n N a t i o n s ? ' b a g ( a f l e t t e r s ' S S M r u s h e d d a y a n d
C e m e t e r y w h e r e a .f l u t t e d n g O l d ' n i g h t a c r o s s t h e p l a i n s f m t h e
G l o r y m a r k s t h e l a s t b i v o u a c o f M i s s o u r i r i v e r t g t h e P a c i f i c
m a n y s o l d i s w 1 o _ l o §t . l 1 e i § ' _ l i r e s | 0 ¢ e a n _T h e a u i c k e a t t i m e e v e r
Q9 :ne 1|»?I:l1C1'lD.DB¥,Ple with I""|nudewaa in iniarch.1861.whan.mans ana zrom nntuml causes..'_|Tm f the ld gre Premdent Linco1n's inaugural ad
Im f:-HS;1 oediawlgon 'mn dffss was wmed from sz. J aph,
sf n y i n f r o n t M n s s o u r i t o s n o 1 9 8 0
f t h e u i l af a c l a m e n| : ¢ - I . . ' ? . , i ' i '. ¥ » : » . h .E . . . a 8 \ -? E I | h 1 " E S . i n s e v e n r l n x m n n fl ¢ ; v. r n n fp m '1
A llrgii numner ox :mms enun-varled Mr. and Mrs. Oscar ScheerSundny evening.
ROSE HILL ITEMS
mn. A. Av.. neue: spew. nnun- 15 wr-"wus u ww uaya ul. aus uwuday night and Sunday with her weeks vacation with home folks.
puents, Mr. and Mrs. G. B. Bunn.The Gall school had A pimlc onMr. Benles came also, Sunday af- Friday at Johns'Grove for the
wrnoon.'last day of school.
Mm-v Can-trudo and Llnnmroi ur..u-- ..-A v-;__:v---|.. ...u|.
mm... . ~g"» ..... "ma .uTo BE A MUS
The colorlnl days of the
.erpress stew be mulled an
m l m
*n n n A c u u l w q l c l l u u b t :n y LIIB - r _ " " " "\ - ' JD o m -W i l l i a m s f a m i l y f o r n e a r l y h a l f a l h ° ' " ` " '.
as5 K £ L C A S
V
Z\
, v
Mrs. Will Hansen, Mrs. MarlonDenman and son, Misses Ednaand
Leona Hansen and Mrs. Al, Clark
were Thursday altemoon visitors
of Mrs. John Petersen..Mrs. Frank Wilson and FrancisAnn visited Mrs. Wlll Ryan Wed-nesday afternoon.
Mr. and Mrs. Prank Schafer and
son, Mr. and Mrs. Bernard Wulf,
Dorothy Petersen,Dorothy andGretchenMenckewereSundayvisitors ut the Detlel Wul! home.
The R/use Hill school closed with
n community picnic dinner Hidny.
A ball game with Bisbee was the
mnin utttntilon in the afternoon.The score was 10 la 14 in favor
of Rose Hill.Wednesday ulter-
noon the Rose Hill teurn played
Bishee at John Tuylor's and Rose
Hill won. the score being 8 to 9.
Mr.und Mrs.Will Ryan andGene, Mr. and Mrs. John Petersen
and Geo. Luse, Mr. and Mrs. Ber-
nnrd Wu'l! and Miss Stella Jensen
were Thursday ecvnlng visitors at
the Detle! Wulf home.The graduates of the eighth andtenth grades of Rose Hill,hadtheirbanquet at the Ed Stork
home.The rooms and tables were
beautifully decorated ln green and
white, the class colors.Dorothy
Sappenfleld, Domthy Petersen andClaHe¢ Ryan are in be congratu-lated on their ablllt as decora-tors.The ninth ml.. served the
menu consisting of mashed pota-toes,creamed chicken,creamedcorn, fruit salad,olives, pickles,ooflee and mlls,and strawberryshorteakowithwhippedcreamMiss Hazel Wulf sang "Roses of
f'fCPPdy"and "One More Day"
vhich werefenjoyed by ull.A
nicely arranged program consis-
ting of a tdk by County AgentBates on "Success"; Cluss Poem byWalter Gosker; Class Will by Leolo
Rasmussen'Class 'l l .
Howard Fackler had Sundny_din-ner with the George Fsckler fm-|~
ily.Mr. and Mrs. Earl Petersen
stopped there on their return from
the mir races at Omaha that |.(ber~
noon.
Miss Ruth Widener completed
this yenr's term Friday as teacherof the Jo`hnson school and is wim
her parents lor the summers va-
cation.
Mr. and Mm W. J. Si momen
and children spent Sunday evening
at the Henry Sorensen ho e.Mr.and Mrs. John_grlgklett
Richard Nelson and Class Historyby Edna Hansen.Toastmaster was
Leonard Appleby.Richard Nelsonwon n box of candy for writing thebest essay.Mr. and Mrs. Norris Wand andfamilywereSunday evening vi#itors at the Fred Jensen home.
Mr.and Mrs. John Petersen,Dorothy and Jock and Geo. Lune
were Sundoy evening' visitors atWill Ryans.Mr. and Mrs. Will Ryan and Mr.
and Mrs. Fred Mayle were Sunday
afternoon visitors at the Babe
Ryan home.
Mr. and Mrs. Norris Ward andMerle were Saturday evening vis-1
itors at Walter Sappentield's.
J e n s I v e r s o n
0 r u m {N e b r a s k a
I a n t a k i n g t h i s r a t h e r u n u s u a l
e t h o d o f w r i t i n g y o u e l e t t e r .
O u r d e a l e r t e l l s me t h a t y o u e x p e c t
t o r a i s e q u i t e a n u mb e r o f b a b y c h i c k s
a g a i n t h i s y e a r .You n a t u r a l l y w a n t t o
t o r a i s e a s ma n y o f them t o p r o f i t a b l e
ma t u r i t y a s p o s s i b l e .The Nu t re n a Fe e d
M i l l s ,I n c . ,wa nts t c h e l p y o u do t h i s .
We c a nno t s u p p l y t h e go o d c a re a nd ma na ge -
me nt we kno w y o u w i l l g i v e th e ~ ,b u t f o r
y e a r s we ha ve s p e c i a l i z e d i n th e na nu ~
f a o t u r e o r th e s a f e s t a n d mo s t n u t r i t i o u s
c h i c k s t a r t e r t h a t c a n be made.
I a m p ro ud o f Nu t r e n s b e c a u s e I k n o w
h o w c a r e f u l l y i t i s ma d e - w h a t s p l e n d i d
r e s u l t s i t ha s g i v e n tho us a nds o f p o u l t r y
r a i s e r s a l l o v e r th e c o u n t r y .Nu t r e n n i s
sa c ke d i n th e G o l de n Ba g.
Th i s y e a r Nu tr e n a ha s b e e n ma de
b e t t e r th a n e v e r ,y e t i s s e l l i n g a t a
l o w e r p r i c e th a n a ny t i me i n h i s t o r y .
l i l k S u g a r F e e d ,the ne w d r i e d m i l k w h i c h
i s s c o n t r o l f o r c o c c i d i c s i s a n d a n e w
f o r m o f Vi t a mi n D h a s be e n a dde d.O n l y
t w o h a n d f u l s ne eded t o s a f e l y fe e d ea ch
c n e i f y o u r b a b y c h i c k s f o r t h e . f i r s t t h r e e
| 8 9
B r o i l e r s o r e g g s w i l l e i t h e r p r o v i d eca s h r e t u r n s t h i s y e a r a s b e f o r e o r s a v e
g r o c e r y a n d b u t c h e r b i l l s ,msybe b o t h .Ba by c h i c k s s t a r t e d o n N u t r e n a w i l l a l w a y s
ma k e y o u a p r o f i t .I h o p e y o u us e i t a n d
t e l l y o u r f r i e n d s a b o u t i t .I t y o u w a n t
J u d g e B r a n c h ' s P o u l t r y B o o k l e t t h i s y e a r ,
I ' 1 1 se o t h a t y o u g e t i t .I t c o n t a i n s
ma n y v a l u a b l e h i n t s i n c h i c k r a i s i n g .
S l n c e r e l y y o u r s .
v . n . l .NUTR ENA FEED lII l°,I n c ;
vcmm
Sold byBIGELOW cv mmun
Hmm, NEBRASKA
Q o o
sen and baby of Florence,and
James and Benjamin Mead of
Washington Springs,s.D.,sonu
of Tom Mead, formerly of this vl-
cinity were Sunday afternoon vin-itors with Mr.and Mrs.C. B.
Bunn.Mr.and Mrs.Opal Reeves
and children were also Sunday
afternoon visitors there.Mrs. Opal Reeves took her son,Max no the Blair hospital clinicTuesdayheldtocelebrawHoa-
pluxl Day.
Mr. and Mrs. Kelley Meyers andbaby of Telmmah,were SundayguestsofMr.and Mrs.Burn
Kelley.
Lena Layman was eight years
old Monday so she treated her
schoolmates ol the Kindred districtfn candy.Miss Ernestlne McCoy was a
Sundsy supper guest at the Ben
Kjeldgaard home, near Teknmah.
Mr. and Mrs. Henry Rasmussenand three children of Spiker, were
Sunday afternoon guests at the W.
J. Boite home.
Mr. and Mrs. Byron Beard andsonsspentSundayeveningwithMr.and Mrs.Sam Steele nd
children..
Mrs.Margaret Pitzer and son,
Francis Mehr.ans were visitors with
ALONG THE
_ u u m m
Mr . a n d Mr s .Ne d Ty s o n h a d n
fr ie d chicken supper a n d spent
Th ur sd ay n i gh t wi th Mr . a n d Mr s .
J . S. Con ety .
Mis a Cora Beard spent Sunday
an dn jlo n d a y wi th M r . a n d Mr s . F .M u er of B ur t c ou nty .
. |A '
~n
offer. W~ will gi~e ~o~ ~2~.~ for
I I
Kitchen Drudgery. .
I R just a few days-until May 30
near Washington.'
Miss Myrtle Paulsen spent theweek-end at the pmntal,Paul
family were Sunday dinner ~eats
1 .
Skelgas brings relief from dru
'.ck book their sisier,Mrs.~ tin Stewart to Omaha Fridaym leave lor Philadelphia where herhusband is stationed for the next
two years.Mr. and Mrs. John Quinlan of
the Haney district.were Friday
forenoon callers at the I-Larry
Tucker home.Mr. and Mrs. Paul Paulsen and
Iamily witnessed the air races inOmaha Sunday afternoon.Mr. and Mrs. C. B. Bunn drove
to Omaha Saturday to see Mrs.
Emma Hoover at the University
has ital, who is still very ill.Hlizrry Tyson sent a double deck
truck load of hogs to Omaha Sun-
day evening.Mrs. Oscar Pedersen and Mrs.
George Hain were 'I\iesduy after-
noon visitors with Mrs.Kenneth
Tyson.Mrs. George Hain and Mrs. A.E.Dixon met with other project
club leaders and Miss Douglas olLincoln.at the rouril house in
Blair, Fdday afternoon to discuss
oounty fair booths.
Willard Chambers of Omaha,who formerly lived in this vicinity
was n Saturday dinner guest of
Fred Ray and called at Clyde
Metzler's in the afternoon.The Chicken Chatter 4-H Poul-
try Club met Friday evening at
the R. M. Iverson home with all
members but one and T-he leader,Ray Krogh, present.May 29 theywill meet with David Sirnonaen.
Miss Jean Slliwaxt of Blair, was
a week~end guest of Ruth Morgan
at the George~Morgan home.Mr. and Mrs. R. M. Iverson andfamilyspentSaturdayevening
with Mrs.Margaret Iverson a t
Blair.
Mrs. Margaret Iverson and fam~ily spent 'hxesday evening withMr. and Mm Fred Ray.
. .:4 -- |l l |~n n 1 0 S '
impo rtan t h is to ri es !relic re c la im- llv do nated th e bu ild in g to th e
ed wh e n the Ame nc a n L eg i on po s t Leg io n p os t.The old e xpr ess ata-
of Gothen bu rg, Ne br. move s a n o ld tio n is 14 b 3 2 f t i iyeen s z e .A d -sta g e s tati o n f r o m th e Ni ne ty -s i x j jo in i n g i t i s a smalle r log stmc ~
c hra n , near the plac e owned by 11133, ture that was us ed a s n blac k-
W illia ms fa rni ly , Nebr . p io nee rs to smith sh op .It r etai n s its o ri gi na l
th o c i ty pa r k a t Go the n bu r g an d _f o r m e xc e p t th a t th e own e r has
converts it..i n to a mu se um.Th e pu t o n a n e w r o o f .
str uc tu re in a s to ry a n d half Cog!Th e po n y e xp re s s wa s no mo r e
bui ld in v T hge fn-st stor y was l or less than a man on a fleet horse
erec ted in 1856, the ha l f sto ry wa s c a rr y i ng a b a g o f ma i l.As th e
ad de d twelve years la te r.[ mo n a n d hors e,c o ver e d wi th fo a m
Th e b u i ld mg is c ons truc ted of Iand dust, dashed i n to s statio n'
Herman,were Tuesday evening
visitors ol Mr. and Mrs. Kenneth
Tyson.Mrs. Byron Bunn and young sonreturnedFridayeveningfahor
home after two weeks at the homeof her parents, Mr. and Mrs. HugoHanck, in Blair.Mr. and Mrs. Magnus Johnson uiBlair, were Sunday afternoon vis-
itors with the R. Widener family.
Mr. and Mrs. George Hain andVirginia were Wednesday eveningguests of Mr. and Lbs. Wm.Bntt
west of Herman.
Mr.and Mrs. Kenneth Tyson
had Sunday supper with their
cousins, Mr. and Mrs. George mdnear Tekamah.
and wldren, were Sundny dinner
ANY WINTER .COAT
CLEANED and PRESSED
d Returned In Moth Pmal Bag for Summer storag
Now $1.25During Month of May
PHONE White 183
We Call for and Deliver
A d v a n c e Cleaners
BLAIR, NEBRASKA
-.. ... ... ._. ... .. ... ..»L.. ... .. ... ... ... ... ..4
n A N c E
KING'S VILIQN _. --I -$K£LCA5'
v
N r
DAMON'SI - l A n M o N I A N §
of Omaha
Saturday, May 23
L~
l k e s t l e s s
1 < 2
CHILDREN
`
CIHLDREN will fret. ollcn for noagparcnl. renson. But lhere'a nl-wnys nslorial llnnnlcss as llie mcipaon the wrapper; mild :md bland us iltastes. But its gentle xiclian soothesa ynungslcr more surely than n mompowerful medicine.Thulin lhe benuli' of this spain!children's remade!!t may bo giventhe linimt infnn -ng often as thereis need. ln cases ol' cqlic, diarrhea orsimilar disturbance it is rnvnlunhle.A coated langue calls for yur a few
drops to ward ofl constipation: andoa any sugeslion ol had breath.Whenever c ildren don'l ent Well.don'l. 'gg well, or hgvgl any littleut -is ure vcgc u c repara-dZ'.fa, usunll nll llml'a nmled.
a*e¢y»~vI ,[ 1 :'~:~ - 13,C A s ~ ° ~ ' ~
u '
-9 -r 7""_4 r ? ¢ - I A *1 - ; ¢ " ' ¢ * ` i ' 4 f /
_J
74
a w *
Nza
, v
=1 ~!ie
A
Above is a lube photograph of person who receives a question
Dr. H. Adelbert White, professor nmlre fill it out and return It imme
od English at the Univerdtv of diutelv.In this wmv it will bf
Nebraska.Dr. White is secretary
of the Nebraska society, publisher!
bf the new blographlw history of
the state, and has been active in
public affairs for many years.
Announcemmt was made at Lin-
coln recently by Dr. Wl-life that
most of the material for south-
eastern Nebraska has been com-
piled and that work is gatng re.-
pidly forward in the northern
counties.Nebraskann will iwudo
the biographies of about B0 dt!-1
zens of Washington county, and lt'
possible for Washington county u
be given all the space ln the vol-
ume to which it is entitled.
"We are more t pleased with
the respons, ao lar", declared Dr
White."Practically all of the out
standing men and wmnsn in thc
counties which are bging comple-
ted have asdsted us in every way
possible.Such _a worthy under~
taking deserves the full coopera-
tion of every citizen.I hope 100%
of the eligible persons in Wash-
ington county will return material
k
u urged by the society Lhnt everylconcernlng themselves."
30
»J " _ J ' " " " " " 'each dm; outside vom' kitchenwill eventually eslmpe long, tedious
kitchen hours, just as city gas users
have. Why not install Skelgas right
now, when you can save yourself
$25.00 by selling us your present
»
Thousands have |¢;nrnluI alma
odmer fuel compares with Skelgas for
speed,clennliness,intenseheagsafety
nncbeconomy.Strike n mstchyturn
a burner handle, and dl the intense
cooking heat of Skelgu in ready to
1 S h a h i d B a n u ) ,Eve ry l in e g ra ce fu l.Ha r m e m la l n g en a m e l c o i o n .: vc r -l u t i n g a n d b e a u t i fu l .Ad d ! t o t h e l n -Ma ra ac a of a ny k it ch en .
2 M a d e I n S l w l x w -D a m n e d a n dbuilt elpeclally [nr wit! with =»=\~,=--Gi ve s hi gh O vt ra tl n g el ll le lc no a nd o wfuel eo naum ptl ou.
7 F r u i t A i r O w n .M e s h ba ke d l nco ns t an t ly c i rc u la t in g Irn h a n
3 Bmm cra R mlotr abla.Kla il y c le ane d.
ju s t a t u m oi t h e w t h ! r c m o vn t h ab a r n t r a .Pu!!! ename led..
g E d u Ta s Il d v( C m t l r u h .V a i n h a mdl e a t ur n a t al i g h t m a n u r e : m a b l a
wo r k fo r v o u.
We want Your old stove von want
to escape ktchen drudger; just as
city gas users have. Lel's get together
on this sensational offer.It expires
May 30. Come in now-test end use
Skelgus yourself-decide quickly,
before it is loo lata to secure this
3 F u l l y E n c n d d .Tb l l a l a n l l fu l l y
c n n m e l u l .In c l u d i n g b u r n e r s a n dn m u n m g w i t h u h m c u n t s o f h l l h u t
If a d c o n r n l u l n g p a n e i a l n e n u nf l l .No th i ng t o p ol l lh .W l o s o i l w i t h
d a m p d d h .B u y t o k e e p c l u n
C o l u d a l M A l l4 h h : c a ae e a le d . .O n l y t h a ~
v a i n ma l e s s h o w .
5 S m a l l ; S u vfo o u .N o n h l r v n r n e r uto l o n : e l e t h l n o f c a t c h d i n .A l lun d u e : . » . . . »~ \ '£ an d : c al l y e he m u d .
g ! . n ¢\ ..i n .l n . l - . L | - _ \ . . .
yo u tn : m rs a ny d r rr n o f h e at e a si l y .
1 0 O w n H u t R c n w l n u r .C o o k s m c
d l n h o r w h o l e m u l c h : o ve n u h h -o u t a n y n t e m l a n o n y o u r p u t .L i l ohaving 1 mn id In th e h avo c.
1 1 B a uc l ifs il l bl o r. Sa i l e nu m a n im a l
with harmn oald ng tr im..
1 3 S c !!- S u p p o r t i n g D e n R a d u .P e nfr e t l y r l g u w h e t p u l l e d o u t fo rlaopeetlon ol NlDki ng Ioodl.
1 3 N o A d m » » D u c . H m l l n ¢ \ » ¢ m y
hs o r o a t .B l e l g u In p s fl e e t !!
Mu er of Burt county.
Mr.and Mrs.Sam Steele and
family were Sunday dinner guests
of Mr. and Mrs. Fred Jungbluth,
near Washington.Miss Myrtle Paulsen spent theweek-end at the pmnta l,Paul
Paulsen home.Wednesday her
pupils of d u lh nh s c h o o l ln
_
0 I I
DAMON'SI - l A n M o N I A N §
of Omaha
Saturday, May 23
825.00 saving.
o ul '§Z£"'~'5. wool ::.'f'.:;z":1:clean uk and Int.hrvr iii.. bent in une. hw Mic hal |n g
Nd and into kd-~ Bath real cannnlencn.
15 F u ll 3 - In I- l¢ » t ¢ »F o u r l u n l o p
b l m e f l .sum mer b s : u f .l a r g eM u l l e t a n d f u l l l i n l b - t n l h l n l u l a w do vf n .Th e u f. - a n b e l u n o r a n n
~f f j x g u r u n u . a ~u . » ¢ - | - | . . ¢ » , n » 4 - - l m _ - u - » ¢ .
BENl)0RF SKELGAS CONPANY
BLAIR NEBRASKA
Bldr, Nebrub. Huy 21, 1981
VIEWS OF OUR NEWS
(By a. Cniagoan)
chiwzo, rp.. MW 19:11-as last
MCCARTHY AND
LONG CREEK
Miss Hleen Thompson is at thepnrenul,James Thompson homealterteachingwhoolthePast
year near Tekamah.She plans too~er'a Day Plum.the commu»
ty welcomed them and the
I Q
t.I . `\I g S ~~
T ~= = = = - >£~_
».. _.,.. . . ..-.
UEF
~nd Sore "Nod
'tis, N¢uralgia
a dzronic suienr from~rany other pain. Them.ache 'Baysus mn't fiuwe; they are
oft to women who elsif;are tnbmking up ,432
only a simple hadadze,.-wg; pr neuritin. Bayer purin is still
n: to mke. _lung be'xhurtyge Eli' Get ui
~lets,in this familiarthe podet.
'A'°\°~'sqv Q»\'(Ys < > }\_
|5
,/
e' ~
A F E
OF |Mrr/wlorq
BETTER PLUMBING
M ans Greater Home Satisfactione
The summer season is the
r' ideal time to install new
plumbing fixtures. Enjoy your
hom e to the utmost with sur-
roundings of modern plumb-
ing fixtures.
Call Us For Estimates
John Moore
Plumbing -Co.
BLAIR, NEBRASKA
with The Churches
BAPTIST cntracn
L. J. Moran. Putm-
.
the church of Christ was founded.
Can any loyal follower of thu
Master let the opportunity ol cele-
brating the 1901 snnlversary of
Iv; fllkhnhizl |\;\\cinnr :.;,;.;;..'.:" a,;';;;:.':Slmd ly S c h o ol a t 9 : 30 ._"`&1Ia1`é gom ru n ay s 'vu l-f lCfViCG fOr tb l ] ~ ll l D " i l l ' l l I \ | |wn fn v I n .....°'f§
fa
01|
the church of Christ was founded.
Can any loyal follower of thu
Master let the opportunity ol cele-
brating the 1901 snnlversary of
the loundng of the church go by
unnoticed!
rests mddnas.Church Camel] meeting Monday
at B p. m.
Yuung Pbople'|Sodety meets
Tuesday evening.
D mm; G u n n mean in church
REUEF
From Headadcs
Cold, and Sore "Nod
Neuritis, Neuralgia
Don't be a dzronic suienr fromlsesdacha, or any other pain. Themin hardly an ache or pain BaysAspirin tabkm mn't relieve; they area grat comfort to women who sniff;
``.are tnrelied on for braking up m:
Itmaybeonlyasimple hadadze,or it may be -wg; or neuritinrheumatism. Bayer pirin is still
the sensible thing to mke. ]\ut becertain jfs Bayer you're taking;it dom not hm the hart. Get thegenuine tablets,in this familiarpackage for the podet.
' "f'A'°\°~`$
Bvie `\\'(
' L
\'- 1,~`
~sA|=E
BQWARE OF IMITATIOHSmm:\|1nnan"r1a|I
FIRST L UTHERAN c mmc n
James N. Lund, Pastor
Sundny, May 24th, is Pentecost
Smday-one of the three grant
Ientivd days of the Christian
church.lt eommemonws the unt-pouring of the Holy Spirit and the
birthday of the church.Chris#
Hans of today need tn re-discover
and appropriaie the gifts of the
7-Minute Frosting
One lmbufan egg white, '16 cup
granulated sugar,8 tablespoons
BETTER PLUMBING
M ans Greater Home Satisfactione
The summer season is the
r' ideal time to install new
plumbing fixtures. Enjoy your
hom e to the utmost with sur-
roundings of modern plumb-
ing fixtures.
Call Us For Estimates
John Moore
Plumbing -Co.
BLAIR, NEBRASKA
vnring, baking powder and con:
symp.M k wdl.Plane in ja !
and covlr tightly.This will knep
In refrigerator for mme time so it
in we ll to ma in np n double ot
triplg quantity to haw, on hmd
for emergencies.Beat wall bdvrn
udng to spread on pw.,
ha l! s le e v e s , lo ng d ~e ~t h ~
without jscketa.Every type o f
Silk Dress you need for moming,
allemoon or night._l t
Henry~Vo¢a,h~|Fashion Center Silk Am., forn g 'Z3;I°¢»Zi2',Z»' ;':':ff'~ surnmer priced nt 53,95 co ua'/s~
invm w m d ns sizes 14 to 52-plain and printed,n h " i m won P flat :npcs and chilfonn-plain
icvnr theeus.G»»hnl!'cupoi mn.»:°e:':f=:°'_1-_!'e&°s°£1'es1=&'1f.,..'£:»*.¢.." ».~».¢';'..w »»é
mv. uns. wno oezennma Ill! vznnblrthday on Mot.her's Day, mmm-
bers sprlng showers that dldn'|
depnsa him.He recalls that when
a boy he welcomed pleasant hours
in a quiet lmymow where he lay
in tl|¢ :wont lmnlllnrr fn-ha mann
Pnme Cultard
Wash one~half pound prune:
and cook \mtil soft.Remove ni!-H
and rub pulp through dave or putthrall h lood-chopper. There shouldzbe about ns cups plgp.Snlgad
wnuue uwne umewmppe uc re am _1 `'l ''mmnbers of the h.cCu.r1.hy Ladies d .f e j h ht m a e , "is ,famed in.'Prcgzeasive Club \`»°come lwld olnxvegvo catytlmg 11 0... Sun-
Annl Puhlt en Surprise the afternoon at her home.Bev-day A dmloe at Mo ~Wor-%mv lvsar.4 tablespoons mteen members mpundedmddzellm'¢w z
water,2 egg whites,Bijint (lialierndon was spent vldting and |,gum gg, be mUnio Memorialwp) cream. 1% teaspoons vanilla, contest given whlth proved nrylnrvicereat 'llc di, hallnnext Sm-
amused pineapple or aerrle»,|§mv§inz-A 4°"==°9~."'?.P°':*3€|._- ___,__.........\.:.. L...-
" °" " " ° " " | l n 1 g In m e m n w m o lllll dreamed the Annu of yvuth.dill m anhm lllm n """"_' T su'-=E`»="`i¥»'<i taunt me*he whll¢_¢-'fn mem, nil dm" mt in W L um In mad pm!! nm ....m""-3I- n m lua.Boll. I.. ul.. D.
n..» ..- A - __-_..-_. __...._ -_-|u:|.n u p Lunar c u nn u ln u p a twr o nthe r oo f.Ma y b e Rev. L a ng n e ve r
sp e nt u r dn y a f te r no o n i n the lo f t
o f a r a mb li n g o ld h a m, b u t i f h e
hnsn't.he missed so me th in g fi ne
I h n l !a n h o
\,..... Lawn I
n r o r u n t i l m a r a h r n a l -w i t h o u t s t i r r i r f u n t i l i n s " '" " ° "* " " "" ' ° ". . . 1'. . . . l n f " _P h i l l ' ~H | \ m a H ¢..,....g£¢._"Y u vu u m n p !\ ': , | . a l l § ? -~M M .L Do not fofget that the 0mhu\
Custard ovér this, using about two
cups or the umount mnde by re-
cipe.Cool and place in refrigera-
tor io chill.Serve with whipped
.. .......-.........,, v. .,..~.......slowly to egg whitu, beaten Jim
stilf.Contlnue beating until mix-
ture is cool.Chill, then add cream,
whipped, and vanilla.Fill smmll
molds nr nannr nnrfnit funn with
um v mnny .Mr. and Mm. Hnyes Rosenbalm
and dnughbers matured to LyqnsSundayand spent the day wxth
Mrs.Ronenbah-n'; brothers,Carl
.ma 'PA §nrnnnmr\,
Baptist Association meets wld
our church Tuesdny,May 26th
Plln to be presmt.Have you noticed how beautifu
the chumh lawn in.Russell Mun
\a
x
h|
n
an H13 ure
An d to W y omin g drove John
Re i d o f He n n n n ,to breathe th e
fres h ai r of e ur ly s u mmer with hi s
so n the r e, an d tos e ar c h fo r tr en ~
su re beneath th e trees.Re me m-
be r th e qu ai nt olal legends th a t
to ld o f n e w o f xto lll f o u n d a t th e
c ream o r w l m lr e s my w u w u
ma r s hma llo ws o n to p .
So ft Cu sta rd :On e f a u r th c u p
su ga r, 1 tablesp oon flo ur,Vs tea-'
spoon salt,2 cups mi lk ,sc olded,
2 c fm' y olks,55 teaspoon van illa.
Mix s ug ar , flou r and s alt, n nd a dd
th is mi xtu r e .l n th e c enter o f
eac h p ut a tea spo onf ul of c h opp ed
mn d i e d f r u i t,preserved gin ge r,
Marasc h ino c he rries, Ruhy ettes, or
n c omb ination o f these fru its.
Sa ri nlde mor e c ho pp ed f r u i t o ve r
t e ton.Plac e mo ld s i n tr n v o f
Mr . a n d Mr s . F r itz Ar p ol s ou th
o f Ke nn ar d,we re Sunday af te r-
noo n c nlle rs at the He nr y W ulbe rn
ho me .Mi s s E my le A r o n s o n me n d e d a
p a r ty sponsored b y h e r Sunday
sc hool tenc her hlis s Graqe S mi th '
dor f, o ne o f ou r c hu rc h boy s dc
serves th e c redit f o r ta k i n g th<
dande lion;o f f thi;la wn .W .W
Fre eland h as plac ed hi s us ual g if
o f flower s a t th e outside fr e n
door.W e o we to h i m a ls o a vo ti
of tha n k s f o r be u u tif y i n g th e y a n
roots of trees?Porhsips you d0'to slightly beaten en yolks.Pour Suer-`rce£of'and:;flo tw'orrat the Mrs. Ojivenot know John Kicrnan, lover of|*°"ld°d milk over f'u'pI'f°° °"f'"' three houns to freeze.o lS"f2'ff"¥f'f'E"'".§1 the
church with a driveway, walk am
imc
tcm
perl
W ||_},1 .ho t wa te r an d cook slo wly ,sti r-§'1"'blu lu.° " ' " ' " " " "" " ""' "" lsh ru b be ry .ll...».,f`..,.».=.""§,,.f"°....?f.2 f§. | , »; .. ,, u ntil rnstamrd thickens.C'ool.1 ._._ .__ __'___|ch1lQr¢gn a p d Mr s .~ F l g g g e i W e nxfpnd tn . th o relati.¢n.n'a
ar n u m ni:3 |n:u wsuvu 1I n ll| " " ' \' " " "" ' " " " " *" "" " " "" "n e w a r e s o m e I C C J P C B l o r ~ T g k n m g h uwerg Frida y HI IBT-" ""'"" °`I'" '' " "" " ' 1 "`m t y ou to k n o w h i m as we ll A d d van illa an d w=e us dCBir0d;an d fi os ti ng s,whi c h with the £lld.f| U¢}mi mr é at th e J o h n A ro r n s o n Allen A. }:'h1llips our deepest sy mthosewh o shake his han d:(Th i s ma k a li ttle mo re th a n o f y o u r elec tric refr ige rator,y ou horrilc.Mr s .Fle eg c is a s i ste r o f p a th y .His 1l¥10XPf3¢i»0dh dex h w a
ere ar g treasures to be found.two c up s o f . us ta r d. }mn n r en n rn in mlvnn c o a nd se r ve .Mrs . Ar on so n.a sh oc k to o ur e ntir e c urc m e m
a s
under all trees, and some searchers]Fruit Whip I£S»E1pErI§f§`rE»if§'i`£:{ §ii§¢~§£'i=l§Hrfimd Mrs
trouble.Qhllslferl mn!
Levn Hindley and[bership.He will be greatly mlssm
find Niki thin gold. The trick is'1% tlbleqgoons gelatin, 1% cups S u n d a y e v e n i h g a t l h y h i s c h u r c h .H i s I o y a l t y ,f a i t h
1 n 1 n H u o ¢ l f n l n n n n »~..I L = n ! n n \ 1 ; n n I A ~IA » |Ev|vOnr n r i l hw Know me treasure, ann to make'use of it in the p roper way . . . or
i n th e proper one mii li on way s."
J o hn Reid has lo omed th a t tr i c k .
an os
The Coll s c hoo l a nd the Summer
so y th ei r " la st d a y " f o r th e te r m.
Colt!wa te r,Ia c up sugar,1 c up
pineapple juice,2 tablespoons
lemon juice,1 c up crushed pine-
apple, 1 cup chopped apples, ',Ez cup
chopped dates.Soak gelatin i n
one-f ourth c up c old wa te r fi ve
minu tes.Mi x s u g a r wi th r e ma i n
s__..n....._...J \...:_....o..s...:1:.....
Stan dar d C ake
15 c up sh orteni ng,1 c up su g ar ,
2 eggs ,I teaspoon vani lla,1 c u p
mi llo 2 c ups pa s tr y flou r,3 tea-
spoons ba king powder, 'fi teaspoon
salt. C re am sh or te ni ng ; a dd s ug ar
siowly ,blen di ng well.A d d well-
n x u u b w u u H a u l i y l u u l o y u sM r .a n d M r s .E l m e r F a h r e n l c r o g
o f L i n c o l n ,s r n m n t S a t u r d a y e v e »
n i n a t t h e J o B a r r y h o m e .
5 r .a n d M r s .T h e o .H a n s e n a n d
Te d d y o f B la i r a n d Mr .an d
L. C . A xo lg aa r d vi si ted S un -son,Mr s .after noon wi th Mr . a n d Mr s .
. . n . . . \ . .1_r . . . . . . . . . . . . .ef.
A u l u c a n ,u n u : u a u \ : v u \ . | u | |u v I
c hurc h was of th e highes t sort.H.
lived his li f e i n suc h a wa y th a
he ha d th e hon or a n d res pec t o
a ll w h o k n e w h i m.
Let us pray the Lorml, tha t som-
one rnay c o me up in ou r c hurc h la
'lnlrn hio nlrmn n ml th a t l l n m mi'."'§.f`_'l"'2'_f2..'ff'! gg1j_"1\{f»ng 'f'°|:'1*f.:"":i... "I'.[1.3'.T"§'...¥"..=1"'fII.'I?IIbench' es:i k d n u u u m p u Ili.lll2}CI.I.»| " r " "r "~IEy o s a n a v o n n g .M r .a n d M r s .C a r l M .J e n s e n gr a ve u s f z n t h a n d c o u r a g e t o g
s n l t n m ]h a k i n i r n n w d e z 'n u r 'a n n A h l n l . . . . , . - . .a n " n \ ¢ !\1.~n. .|:.. ..,.. ..|..n n
M ans Greater Home Satisfactione
The summer season is the
r' ideal time to install new
plumbing fixtures. Enjoy your
hom e to the utmost with sur-
roundings of modern plumb-
ing fixtures.
Call Us For Estimates
John Moore
Plumbing -Co.
BLAIR, NEBRASKA
dents, and with them c ome picnic :=s|
in wh i c h th e y o un g ste rs ga ve way '
to ai l the pent-up exc i tement o f
vac ation plans.Mi s s Bia rg uer iw
Le mo n an d Mi ss Es the r Hu g he s
ha ve their pla ns £00 before thcy '
ring the f irst, bei ! for c las ses n ext!
fali.W ill it be Ca mp with the su n!
ri a iu g br i g ht a nd ho t in the e ar ly
hour, swi mming an d Hding . . . ami
rest f r o m sc hool an d prec oc ious
children.Or wi ll it h e ed uc a ti on al
travels with tales o f an c ien t. Rome
an d c o lor fu l Greece to pa in t i n
glo wi n g pic tures f o r these sa me
y oungsters as th ey struggle along
wi th the du i!wor ds o f a h i sto r y
boo k?Pe rh ap s it wi ll be i n th o
sh ad e o f a fr ic n di y tre e, th er e to
I
PETERSEN
MACHINE and MoronSERVICE
Auto Repairing s Specialty
BLAIR PRODUCE co.
T. H. Wright, Prop.
Indenendent Cash Buyer of
POULTRY EGGS CREAM
Phone 206 -Blair, Neb.
BLAIR Fuoun. MILL
The Home of
MAINTOP FL-OUR
(Handled by All Grocers)
We exchange wheat lor flour
P. S. Sorensen, Prop.
FARRELUS
CAFE Mid ROOMS
Home Style Cooked Meal
Bus Depot
A J. Hargett, Pastor
Morning worship, 11:00 A. MYoung Peoplc's meeting, 7:00.
Evening service, 8:00 P. M.
l\Iid~week meeglng,Wednesday
8:00 P. M.
Sunday School at usual hour.
Uniun Memorial services at tbl
City Hall ut ll o'clock.
Lord's Day. May 24, is Pentecos
'I'h¢ Iard's Supper will be ohser
ved at the 8 o'clock service.Las
year 100 were present on this oeca
sion.Int us make it 150 this yea:
.
bravely on
The Jenscns wcrc febed in Lin
~ ,na you/z EéféwithMr .and Mrs.H .C.Jensen,
and Mrs. J. P. Jensen driving down
to attend th e Ta u Kappa Eps ilon
fraternity dinner and Mr. and Mrs.
Ed Jensen driving down to the
Kappa Delta sorority house to see
th ei r d n u g h wr ,Alic e an d atten d
th e banquet.Th r o u g h ntll th e
y ea rs o f lo ve an d c a re , f ro m ba by
shoes to »u par ty d re ss an d th e
Ii r s t lo n g punts,memori es c a mo
flo odi ng ba c k to these proud mn-
th er s a n d fa the r s wh o d i ne d wi th
their dau ghters and sons.W i th
the fi rst he artac he ove r n be au or
sweethear t, it was mu| .her' s solac -
ing a rms a nd e on solin g wor ds a nd
fa th er 's unde rstand ing an d cher-
ished c onfidenc e th a t soothed th e
hu rt.Did these reminisc enc es put
added tende mess l n th e glanc es
th e y o un g f o lk s tu me d i n th e d i -
rec tio n o f thei r e lde rs?Ma te rn a l
love i s alwa y s the re, th e shie ld for
th e in e vita b le h ur ts th at will c o mo
to sensitive y outh.A n d th o ug h
th e f led g lin g ma y tr y i ts win g s i n
th e i nviti ng expa n se o f th e wo r ld ,
it' s nlwuy s the pa re nt, the pr ote c -
Don'l' Rusp Your Thfoal'
With Harsh
Irritanfs
Reach for a
LUCKY instead
Nowl Please!-Actually put your linger our
your Adom's Apple. Touch If-your Adum'|
A Io-Do you know you urs actually touch-
tor to whom thoughts will turn
mce£ingof the W¢;mnn's Club in'
Herman.This Lime it took placeat lhe home of Mrs. Henry Truhl-1
Ing your larynx? Thls In your volco box-lt
contolns your vocal chords. When you con-
sldor yourAdam's Apple, you are consldorlng
your throat-your vocal chords. Don't rasp
your throat with harsh lrrltants-Roach for
ss LUCKY Instead-Remombor, LUCKY STRIKE
lsthe only cigarette ln Amorlco that through
Its exclusive "TOASTING" process oxpols
cortaln harsh lrrltants present In gy v g -
baccos. Those oxpelled lrrifants are sold to
manufacturers of chemlcal compounds.'I'hoy
oro not present In your LUCKY STRIKE, and
so w ts a y "Co n si d e r yo u r A d a m ' s A l o . "
Again there vas work plan
ned and executed which will en~
able their Club to mrry on its
work more efficiently.The ad-
vancement of the world is probnblyexemplifiednobetteranywhem
n in the activities of wnmen's
organizations.Their work hasi\: I
taicn its place in the impohami
Now. I'm n. man of my word.I
mean that I'm going to try to get
on thc radio svme night to read
from The Enterprise, so that you\
can hear mn.You renders can
hurry that night along, if you'l}
nach write mn a letter telling me
that you'd iike to hear the sound
of "Chicagoan's" voice.
NEW iENGLAND NEWS
Anrlmnun"F1§.§"E{£ni1a of thc himh schoolsprung rn surprise on their teaeher,|
A n a Curle y , i t bei ng h er bi r"th day |
Tuesday .Sh e wa s g i ve n a h a n d -
kerc hief sh ower whi c h plea sed her
very muc h.A iarge c ro wd f r o m N e w En g -
la nd atte nded th e c ommenc ement
exerc ises i n He r ma n Th u rs d ay '
evening as so many graduates were
f r o m the c ountry .A fu ll ho us e g re ete d th e g ra du -
atinrr class o f th e N e w En g la n d v,;l l
\~address was givcfl by Revf I
M-:Connaha of Lincoln,whl
grcompanied by his friend,
:wi-s\Ifs wasted'Miss Hazel Bridwell entertained
Mlsses Rnih Jnrdnn and Ana
Curley at a six-thirty dinner an
Thursday evening.
On Friday evening about lor'-Y
friends gathered at the CharlesKrohn home u a hrewell gither-
inz for Miss Ruth Jordan.M h l
Jordan taught the lower grades in
our lchool dm put nine month:
Including the use of Ultra Violet Rays Th e Lu cl y Srr llx
D ¢ u o : 0 vr l u . n r q ,
c w fc v T u e s d a y ,
T h u r s d a y a n d
S d h n d m w v r b l t
o u r N . B . C . » a -
Sunshine Mellow:-Heat Purifles
Your Throat Protection-ugalnsi Irritation-against cough
Blnlr, Nebraska, May 21, 1981Plan Four { \ » f n | | r | » . . | I f f n ¢ || f | n \ | ¢ A u » »l " n u u v \ ¢ | \ 1 |' . * ' ; » l - ! ¢ . | I - . .a . 1 . - &ar!! ina fm lfrhl |\»m»f¢ nf 1| nn.. | mn nnilon broke ill falter! of re-
n m E N T E R P R I S E
¢:_~1 \~i.?'~§¢f 3 ~~$7 A __|f
~C N D L E , a
~"~I N T H E
(0 ~ ~ w | L D E | 2 N E s s
~~l$<I7E¢le eff/n€.Bq9'innzn_f'
'\q w . / \ < w @ n f z ¢ n J ».>
Every subocrlption |.|'mg\|.'d»d
u open account.' r m m m e o d
nhucdben willbe un?-nntly ro-l o v e d f m n o u r m d l b g l l n n t t hc x pl nd o n o f t h i t i n tr d d to ri !
£5 puhlllharu be notifod; otha*-1r||e¢bembwriptionwi1l~nm\!n
ln'to me a t the de dnnted mi r
Oalpkian price.Enry zu bwdbe f
u n z m a m u n d u m e m n a m m -
do ns ue mn de np a rt o i th a e o n -c a n betwan the publinher md
ubccriber.
C H AP T E R Il
W lllls m Fllls In L ovs.
A T DOCTOR C0'l"I`0N'B partythey mea the pm men or me
pu-lah snd some lstely snlved.
The dinne r w as lon ed st twe lve
u'clock.To thelr surprise they
found both Endicott md Dudey in
s z e nls l mo o d
Governor Dudley ss ld :"Y ou ng
men. I c sn flva y ou no better c om-
pliment than to any Lbs! y a n look
m u c h u m . "
Many spoke of their resemblanc e.
but under the sklu were were sub-
tle differenc es not quic kly disc ov-
ered.W llllnm, of s fu mlly dlsu n-
f f m A . B a r n u m n u m :
C;pqviqis
The Price of Privilege
(By Bruce Catwn)
Chicago is just catching its
breath um- n heated mayoralty
election, New York is shaken by n
dozen charge; of civic corruption
and inefficiency, and the old ques-
tinn ol honesty in municipal gov-
ernment is coming up once more
Enuend u pecvnd-chu mattax
a an pos to fli oa » ¢ mm-, NmundertheAc t a i C w n v l a t
lm-.h s, 1519.
~za *
|'f|¢*D¢1'Yur sm
W hile mn talk eiglged the oth~
ers W lllln m an d th e girl t i v e
thoug ht m thln gs o t an lnte reltllm-
ned to themselves." Te ll me o f de m- o ld E ng la nd ,"
she urged."lvhnt were y o u doi ng
there?""Sc hool,mostly .F o r 1 ti m e ' l
was a page to the and of Linc oln."
" A pa ge !w h a t dld y ou ha ve
to d o?"
"I wn s In trn lnln g to be a nq ulre
and i ln ully s knlgh t.I wn lle d o n
my ma s te r a n d mlltress . a llen ded
In the c hase.Se r ved me lh d y ln
her h owe r.W as muc h lnslruc tedbythe c lmp ln ln, the la dy an d h er
dnms ell.Offered the nrst glass of
(er tlme and envlronment.Theywere nearlnz fort! years ot age.Mr. Brade had bought und wasclearing a bl! tract of land andproposed to he a planter vvlth a
lenantry.The lad!sald:"God help ns.
we are cheerful-not !et solemnl-
led by the heavy troubles thu!have come lo many at those aroundna.We have horaea.Every dnywe fldle through the duaky woodtothe plantation far beyond the
neck and look after the worhenand have excellent Kood times.Athome Ben keep: the honle merryl'
gn-alnL "My dear. what have youdone to me?" he asked."I too umburnlng ln the same ure.n I nm
to have a hath. of cold water I
might an well get lt naw as Inter.
You have Iaut your beauty to allnatureI see It evershere.I loveyou.Tell me, pm I be crowned
wllh gold nr wllh thorns?"Be look her hand.Sne withdrewn and turned away from mm. cov-erlnl her face, and lald:"Adon-lahment does not become me.Imalt hide a moment.""I will not try to hlde the truthbecause I c n mt .1; la too \{lK|
(Continued from lun week)
On June 1,1910 he sold theplant to the Bullock Public J.,.vloe
Co.but the company soon want
into the honda of n receiver, W.
Johnson and then 'later to Henry
Maxwell who operated i t for
about a year under the name of
the Nebraska Gas and Electric Co.
and managed by W. C. Ross.I t
wa s nut purchased In October,
1914 -by the Cvhtinental Gas and
F l n n l r l n r u .
and the M¢,;;'E6i£I>l\n§'i§}£Hé
erection of the building and the
installation ot the machinery.
Even after the election and tho
letting of the contmct for plana
and building the power company
did not case to light w hold the
1:... Ttory and a temporary injunc-
tion was asked of the courts to
restrain the carrying out of the
contmeta.After a hearing of the
petition made by the Continental
Gus and Electrlc Company, Judge
___.......,_.......- ..... _ w __necessity instead of a Iuxnry.The increase in the income of
'tha plant has been almost pheno-
menal.I n 1900 when Capps be-
came the owner the groan monthly
income was $165 while for the lil-
cnl year ending May I, 1226 the
g g g w monthly income was $3'
Along with the light plant we
now have a municipal ice plantwhich, while no pm ol the Cighl
plant,_ia in_connectlon with it and
" A n a un lo n gmg m r old E n : - lLand,"u i d her husband."Sti ll,
wi th my h m | \ y , my vl ve . my ( u k
I n d my h o r a a I ma k e ou t very
well,"" I h e a r th a t th a n u e lla n l a n d
tigers and unlc ornn lu- buc k ln the
wilderness.S o me n y n I n wlder
to be hidden.'rnen-in lon!! to nedlscbvered."She uncovered her flee mn as-mmsd n look ol pained sux-prlle.in vnnlnhed ln A smlle.She tookhll hand ln hers and whispered: "I
am sorry-"Hd nnzwered:"Your ere:and
During these changes the sen
vice was pour, lights were on and
of! at any time.At tha most in-
teresting part of a public enter-
tainment or a church service the
audiences would be left in sudden
William A. Redick denied the in-
junction md the contracts we n
ran-ied out as agreed.I n 1910
the old plant burned down and the
d w close the discussion and bervrid oi more trouble purc d the
,,_.L...,__._..__.-. "_ _ _ -_ _
nausea in uae same building.
The power Q" the ice plant is
obtained from lm light plant. This
gives an added business' for the
li g h t p la n t du r in g th e s u mme r
sea so n wh en th e lo ad o n the p la nt
. . . M u - . . » . . . . . | | . .
e"
than the sea.There are Indlanl
worie than the moat cruel bean.They subject thelr captive to the
vllelt torment.Bu t t he ne lr uv -
awel are now friendly, and round-
ab o u t u s there ar e n o beasts to
ha r m ' on e mve wo lves th a t s o me
time: klll the sh eep."
A t t h e d o o r Mn .Br ad s na ld toth e y o un g men , " Yo u wll.l llnd a
'felc ome ln our home."
Ellzabeth turned to W llllum, say -
y o nr wo r ds ar e lu d lu xre e me n t. "
"Ho w c a n I lo ve y o u r X do not
even kno w y o u.""lt ls e a s y to k no w me x show
you my heart.There ls n othing ln
lt sa ve my love fo r y o u.Te ll me
h o w to wln y o u .f o r I m u s t have
y o u f or "3 o wn. "
She hal his hand ln hers as she
eald:' T h l n ls madness.Tr y to
pu t lt o ut o f y o ur h ea r t.I t l t l s
lmno ss lble tell my fa the r o t lt,I
darlmess.T h e po we r si tu atio n
wa s e qu a lly as h a d a n d ti m e o u t
u t mi n d th e sudden cessation o f
po we r wo dd c a u se ` the ma c hi n er y
at e ver y b ud n e s a p la c e i n to wn m
no p a nd mu c h valu ab le time wo uld
be ( os t.Th e annoy anc e bec ame
unb ea ra ble an d th ro ug h th e ef fo ns
o f Th e En te rp ri se publi sher,th e
la te ~_F.lIiltun,__assiat;ed lgy
cusurxuuung sy uwsu ur.u n :po we rc o mp an y a nd th e fi g ht was over .
Th e mu n ic i pa l elec tric li g h t
p l a n t u p t o th e pr e s e n t ti me h a s
pr o ve n a g r ea t b e ne f i t to th e d ty .
Th e be s t o f servic e h a s been
ma in ta in ed a nd the r ates f or lig ht-
in g p u r po s es h ave b e e n ( ar b elo w
th e ave ra ge i n to wn s o f th e a lz e
o f B la lr .
-wow .mo mmy vu we a ng r lwu lf .A n elec tion fo r th ¢vo tln o !
$20, 000 bo nds fo r the ere c tl o f
F U' e i g h t b u n le e p l a n t w herd
in Mar c h 19 2 1 an d was c a rr i ed i n
fa vor ot th e b u ild i ng of th e p lan t.
W o r k wa s s to r i e d a s so o n a s th e
weather wo uld p e ml i t an d th e
plant got into ope ratio n th e follow-
i n g summe r.Th e lee la ma d e
f r o m t h e e x h a u a t n u - n m f mm n mlm: with a smile:"Queen Mary I ...J umm mm hn muld heln vnu out |.1onn ri. Aye me ngnr. was zauncn-|rslecmc power is new pumping uihi ;a..a~"s;sa;.'E2%'..§';I.' ;,;:.(Continued on page eight)said to the poet who had kept he}waiting,'Young mon,y ou kn o w
y our duty .If y ou are careless you
may find y our head i n a basket
so me da y . "
fr"a`§v`£§. "ii i}Bt`é5i:§e Bfiei to Eno
a n d I wi l!soon c onvin c e y ou that
I um not wor th the both er.Le t o n
no w tall:of sheep and c o wl."
"No.If we c hu mze the thome let
ed f or a mu n i c ip a l pla n t wi th .s u f -the c ity wut-er an d the power uoers
fic ien t. po wer to CSU? the load.I t o f B la i r depend almo s t enti rely
wa s a lo n g h a r d ba ttle wi t h th e upo n e lec tr ic c ur ren t.Th e gr oc er
c itizens o n th e onc side a n d q w gr i nd s hi s coffee,th e b u tc h er id s ==!.A .1fJ
!
!9
\
._
\
F
*.
3
asnaiis and turtles"I think that mine ls mlsslng at, me tammy was h IB n one by
election was called on Sept.29,
1914 for me purpose o!voting
bonds in the amount of $35,000.
The election carried and :L contract
was made with Struve and Hines.
THE HACK SAW
electricity, the ironing and even m
the heating of lhe curling imnthat curls my lndy's hair.Indeed|
the people of Blair have become F0thoroughlyggu on the use of:
' _f t h A m e d a fu l f i l l e d I l l I U C H OI I F B D I D I D G B i l l i e *W I U B I 0 m y III BS IQT B DU Il l! ! HUB BI S.n o W _ " w a s h l g l a u g h i n g a n 8 W £ l I g g ~OOIBK g f g l u nt o P'%f§"<=t h e m m d 0 e c r a f t ,h a d a m i l d e r a n d m o r e g e n ~W a l l e d a t d i n n e r ,h e l p e d w i t h t h e W h e n t h e y o u n g m e n w e r e g o n e £ 1 9 2 g m g g m w l n s o m c s n a i
c a n ca t s z e n .e r o u l t e m p e r t h a n h i s f r i e n d .R o b -d i s h e s , s e r v e d t h e n a p k i n a n d e w e r .a n d t h e s l a v e h a d a d m i t t e d t h e S h e a n s w e r e d w i t h a l a u g h|1 \ 'n no a t v i n £1:oVe1'nll'1E1l|5»t h o u g h , |e r t .o f n f a m l l y o f s o l d i e r s .w a s I c o u l d b e a g r e a t h e l p i n y o u r n r m i n a t o t h e i r h o m e .t h e L a d v n . r . . 1 . 1 + o n n n h | h a n m m a f f a i r '
».l
m ` " " ` §fhi;`§g W e a ll g i ve i t made of sternei' stuff,Hé r h a d n house!!_ii`f"1]¢»,§¢§n§"""" " " ' " " " " ° " " " " " " " " " " ` "l i p a s s v k g b u t we seldom h a ve keoner relish for desperate hazards She Ioo ked .ln h i s e m and an-Qrrj him light the ruslles, I must "The n wh y should I in ma te It?
any hieaxi iéea how to get i G e m -- lik e that of n c l n g wi th the swered wi th a s mi l th u h t r Ha ve I no t wh a t our w m has°\°¥°t l k t o .I llL C l b I..._,._,,___kln¢'| omc er--and n c ooler held in whi c h was lon g In hi s me mo ry , "I "'|,_.,n fies .iiw h é m m i .3 0 3 3 g g cul1g§i____the bounding pulse of
THE HACK SAW
\. .n
|i\... Zf" .. . . .-0
'\
| .
1:1r
VOLUIE 5 Blair, Nebraska, May 21, 1931 Number 41
Arnnong the appropri-
xte gifts for young
men graduates are
zvvcralls.
The new "DEVOE"
Floor and Deck Ena-
mel is equally good
on wood, concrete or
linuleum doors.I t
dries dust free in 1
hour and hard i n
about 6 hours.I t
ha s n handsome,
glossy finish.I t
washes easily and
withstands al ies
md t e mp e r a t u r e
:hanges.It is dur#
able and elastic, and
POISON
in Your bowels!
Poisons nbsorbed into uae system
from soaring waste in the bowels,
cause that dull, hcadnehy, sluggish.
bilious condiLion; cont the tongue:foul Lhc lnulh; sap energy. strength
and nerve-(owe.A lilllc al Dr.
Caldu-ell's Syrup Pcpsin will clearup trouble like limi.. gently, harm-
lfsly. in n hurry. The dillcrenee it
eil] make in your feeling; over nightwill prove ilamerit lo you.
Dr..Cald\vel| studied conslipnlian
lor over for1y~seven ycnrs. This long
experience enabled him lo make his
pr~;;-~¢pLion just what men, women.
old people and children need lo maka
their bowels help lhemselva.I l lnatural, mild, thorough action anditspleasantLnsle commend i t lo
everyone. That's why "Dr. Caldv/ell's
Syrup Pepsin," as it is called. is thamost wpular la;aLivc drugstore: sd-L
»I
|choose from.
J u st ab o u t every
piec e of juic y gossip
.....~Da. w. B Cuowr u§
SYRUP PEPSIN
A Docrork Fmn/_U Lfzxa/irr
gerationl
See the "Mayflower
still and wagging
its tail."
For Salc~A goodu é l Perfection on
Stove (3-burner).
The big trouble we
have with thi s wl
money is that it
usually refuses to
answer.
Use DEVOE Paint
and Vnmish pro-
ducts.A Paint for
every purpose.
Ain'|;nn re pecu-
liar?The cater-pil#
Elec tric Re fr ig er a-
tor.
10 %reduc tion o n
F L O R E N C E o n
Stoves;1 5 %o n
F L O R E N C E Oi l
Ranges.
Li ttle Ma r y w a s
ve ry mu c h int,eres~
ted i n th e old-f ash-
ioned gr a n df a the r ?
zloc k. W hile she was
sta ndi ng lo o ki n g a t
it he r mo the r c d le d ,
" I s th e c loc k :run-
ning,d e a r ? "
" N o " ,said I-la'ry,
"i t' s ju s t stan di ng
hll ovm m~eUm bedbul |in't lo
partleulu.
Now il E. time m
PETEHSEHHAHUWAHE
W~ have ~d, free~
seed in bulk.
Blair, Nebraska
willy we let. 1: 8° by °°"F'"'""S| facinsr them. He had not w1umm's I think that 1 will enznge you audi »i1'.L`\}m.i a nu aueov¢rea1'° her I .JE .££'f Eff. '.T'i'I: 2!}."£i._II¥that there me some dreadful ras-
bls in this world and that every-
thing would go smoothly if only
thoy could be quietly chlorofonned.
ski ll ln choosing words to serve | mainly to serve the liajf with c om» |`"5$\v|;f[{1,m-
hlrn Timaru ivan i n lnhnn-n nvnnn nlhn nni l'9 .|-|\.... ....\....a 'Lmnu ulul. uuuu ueuuu Luvu.: numull l u h .; u . l l i " u n Q u l l l u vl u bnll kz.l l l l uand reflneme n t i m t h e m a n n e r s o f -- £? § "'?1 - ne w R o b e r t w a s a n o t h e r m - : i : ? ; e m ; ; ; g . _ ° 1 ' 1 1 ¢o n e m a n !I w " ' °1 vl t t l I n l m '
W i l l i a m , w h i c h R o b g t h a d t r i e d I n p a g e l n t h e g r e a t h o u s e .H i g h s w e a r x r b y t h a h e a r d o f P h a r a o h .e r e d w g # g g d " t 3 , ° ° h I:t
va i n I 0 n c q u l r e .8 WEIB o f a p r i c e ;i l l l d r e p e a t e d 1427108 O f t h e | 1 ¢ g a m e h e y a p a r t l y b e c g u g g o f n EFBB,a l l Q F 0 0 8 8 EP,u
| | n | } A 0 n n l u l f n h l »C.....f..,.,.f| " | n» . \h i m . . . q u n i n n n a i l k ; # n a l n n ; n i A n m n ._. - _-A _..._.1.|..|\. ....|....\ v_1\.-1.S h i ! ~ ~Bn!|¢'s really a complicated
motlem.A little Damage in theIu g u u h H y u n .u u u I ¢ | | a u ' C ¢. | . u c = | I :y o u n g m e n h a d ' P n r d t a n m u r m -
thlea, y et they had done no worry -
ing about their souls.I t mu s t h e
admitted that neither was qolteprepared for admlealon to the First
Churc h o f Boston,the gate of a
way atr alg hte r a nd n arr owe r than
an y they had known.They had
been familia r wlth the fat rump of
Iusggry and zu lloenle.___
l u n ;| C u u L U u u n :a u a a u u c u a .U U !y n '
tron ao tha t he had to out do wn
his household.w e we nt h o me
Our fathers were in hard times.I t
was nec essary to put money In our
pu r a u .We begun to hate ty ranny .W e bec ame rebels and fled fr om
England, and here we are."
"So lt wa s wi th my father and
the rest of ue.H e ls a son of
Slr Edward Brade."
s p e e c n U I f r u u u l u m c r I .n u w ,w a t
In wha t I c a ll des tiny ."She told then:|o t a ll that the
y ou ng man h ad sai d. a n i t lt had
been as precious as the wisdom of
Solomo n, an d ot the no ble lo ok or
hlm ln sa y ing lt.She c rowned her
enthusiasm wi th n trembling ser!-
ousneas."Ile ls ador able.I h a ve
said that the words of Margaret
W inthrop to her husband In the
Aa W i llia m rose to go she add-
ed: "Consider the humble snail. He
never h unles ."
" Th e luc ky m a l l has no cloc k.
It la late i n B os ton .E ve n n o w I
moat ar gue wi th th e c on s ta b le "
A t the door she whispered:
"Come bac k to me af te r y ou h ave
seen my father whatsoever he may
s a y "
gotobiogrophy of LincolnStef£ens,
the famous old "muck-taker" and
one of the wisest students of gow
ernment this country ever bred,
L
Qhed, some inrmsurig light on it.|
In this naasasre Mr.Stef!ensmill of;¢o;|vera;t\an he once Ind
with ihe lata Tom Johnson, nmmu
two decades ago as a reform]T h e governor kindly okered to
se n d I ma n of the be lt ju dgmmt
as to lnml to help them nm! n good
slte (nr lhelr plantation.
n w a s w h l l e they we re la lk ln g
wlth hlm that they were Introduc ed
"A gre nt stnte sumnl On e ot the
klng's.oppnsers ln ihe pnrllnmenl.
A speech o f hls helped to ma k e
me n reb el.""Strange l" she exclnlruw tho\|ght~
fu llv." Th e sumo wln d blew ns
le tte r wh ic h he re a d to me.were
no t well chosen.l wa s n f o n l.I
could no t wr lle th e m m n e l f :' I
wlsh thn t l ma y alwa y s h e plen s~
lm: to thee.I \\' lll a ny to the e as
Ab lz nll sn ld to D nvld :I wi ll b e n
we new eww lv mm wuwn;l m o hls eyes.H e embraced her
nml their llp s mel.
Th c n . s h e snld l n n whi spe r:
"Y o u th le f l Now g o home nnd for-
ge: dll about thlg. lr ypn can."
mnyor of Cleveland.Mr. Steffens
asked the mayer what caused cor-
ruption in po\itics,and Mayor
Joimson renliéd 4" "t -th u h t t h a t i t w a s to the most c omely girl ln the c ol-ové i th e se n- -m grandfather was servnnt to wash the feet ot m alt y ou c an." he aal_d to himso4.**"=,.,%?~'1-2 5 a.........:...ui 4-0IlV.Miss Ellzfibiélh B1'il{IP.She In nnvr tha .r¢|| 1gn nf vnnr nnmlnr I n H l " '5'88 he \\'0llt li\\I¥}'."u llllt 8 D r e lllrym m p o l l u c m n s , " g g " ~ W waadmsd liken lddy érrashi¢i:};;; ;;.';:,; ;.;'m3;,;== """ " °"`1*i£»sw@11 Bradeandhiswlfewere bn of lmpudcncgl"be pretty good fe ows.en you .ughln_in London-satin oversklrt, vlrngo Hp h an dest!_Wh 1 g,blamed the bad busmess men who sleeves.with nuffa old Flemish 1,mf`I»-f"'"s ns'0 n"\1u Lmw Hou!" nnld hr-°-'rmq rm.. 1... f~,...¢:......,a wr.....¢ m..,.1.\
brlbf.-d and that those who did wen!
pretty good business men. The little
businessmen dicl.n't bribe;so you
invented the phrase 'big busineas',
and t.ba¢'s as far as you and yourkindhave got;that it is Big
Bxmlness that does all the harm.
lube. rife und éostli Jawds in her;
halr and on her neck and wrlota."What a ulory ot youth!"thegovernor exclaimed as he took herhand."I could wllh n were notmy duty to chlde you for thls rlch
attire.It qunrrels with our teach-mx and ls ahad exmnple."
She turned toward hlm andsmiled. saylnkz "I wonder."Quick-
ly she asked:new world?""One, needs help in the task ofllklng ll," he answered."I beginto have a hopeful teellng,"
"Oh, you vrlll bo running away
"Do you llke this
..., _.,..._, __...,.... .._.-.....ls llke you-un avalanche ot en-thuslusml I knew lt would comethat way.Rostraln yourself.Weknow llttle of the young man.l'llwrlzetaEnglandforInforma-tion."The glrl suld: "You muy write,
but I-I am not ntfllcted wlth dlm
uv ue v vuuuuc u nun "wa :
LIVE STUCK PHIEES
ll QIIIITH nmlulIsouu.Here they blnme onetor bé-eye; and the Ignorance of ue'||'\ |U U U | | |U| | | | 1 | | | '\
olm:young They wnnt you to L re was said,but than I5 |~. n ,.U a l : nr"He1l!Cm't you see that it's|Quickly she answered:"YOUshgplgi have zr1\¢9 for the 5ouqg."nrivilened busine§ss that does it'!'|
W hethe r jf/ s n big ste am railroad
that wa xfts a franchise or s little
gambling h ouse that wants not to
be rd d ed ,a tempernnce society
th a t w a n ts n la w passed,a p o o r
little prostitute, or u big merchant
oc c upy ing a n alley f o r stora,,.;
lt's tho s e wh o se e k pr ivile ge s wh o
c o rr up t,it' s those wh o possess
...-:.,¢|....... ms....\..r..»..|mn - Mr n m t
"I na ve ( rar e fo r every o ne b utmy self," he answered.
H e exerc ised th e lic ense of n
govern or, be lnz n ot himself p lain-ly dressed.I le wo n a b lu e c o a l.
'hroldered doublet, velvet hreeches
s u d wh i te s lo e k ln n wi th ribbons
at the knee.Only En dic ott was lu
sud cloth.l'lls great wh ile llnc ncollnr over his eont as he c ame la
had re minde d the y oun g men or n
llnn '| man e
nurry up an d gro w old and s olemn
and (now she whispered) get y our
soul saved,'I ' h er e ' | mu e amu s e
men t.Ma n y thi n k lt's wic ke d to
he merry .One mu st ne ver f orget
death and ¢o to all the funerals.I
wish th at Go d were not so ea sily
offended here. IIe's more indulgent
in r~:nzmna.'-
The wine had been ourod whpenDoc to r Cotton a rose and said:" l
enough.
A dialogue la th e room o f th e
y ou ng me n th at ulghr.wu s of a
like nature.
Rob ert sa id:"Coming home y ou
were as one c ounting the stars.Ispoke but y ou dld no! henr me. Are
y ou li l?"
W illiam ans were d: " lt I am, lt is
a k lh d of .lllne ss of whi c h I wou ld
to God lhere wofe no euro lt h l n k
r a l u a l u e VUBHK l U l U " L U U
Lower - Top $8.65
\A 25-350 DROP IN HOGS\
La mb s S tr o ll! to u Qu ar te r Hi s h -
e r th a n L a s t W e e k .Snr lnxers
s9.so@1o.o0:I-'ed Lambs $8.50
® 9.00:S h u m L a m b s $'7.75@
8.25.Fe ed er s a nd A ge d Sheep
HOW ABOUT YOUR
SUBSCRIPTION 32
DOES IT EXPIRE SOON?
Read the figures opposite your name on
the yellow label.They indicate the
month and the year when your sub=-
scription expires.
Every subscription is regarded as an
open account.Names will be re=-
moved from our mailing list when
your subscription ex pi res...i f we
are notified . . . Otherwise sub-
scriptions will remain in force at
.the regular subscription rate.
Notify us regarding your subscription by
card,telephone or letter.Not by
means of your mail man.
Price $1.50 per year
THEENTERPRISE
' 'Blezi1"s Leading Newspaper' '
P"j'§=§»~=»="*"' \.|\.;L|\|"""" " " " * "" " " ' _ ` , " "SHOW mul we \uz|:1 uraunlug or one u.numu cuuuuu|.un:u|.auuu urs wepolstzc mns.Ca n ' t y o u see th a t? "Olin:s.l" ; " 1 ' f & [ ' f p ° k 'm g g f g m to an other Is to some nn offense.have seen In the pretty comedies Sffeady
Mr . Stef fc ns a dd s:¥_u.'..u_y 1.._{`__rf f ..'§_°._i'§but I havé no vnln purpose In pro-of W i l!Shakespeare.Th a t smi le !. 1 v. _ .
1° 'yes was more like n flash °f zll1otlll2l!|1te u special 1na.,1¢@1;5a=Is t tha n a sp ee c h , an d as 1 too k Miss Brade turned and greeted
i t i n a n d shed it,aro und i n m y the y o un g men and quic kly c hose
head,he added:' I t is privi lege petwgen thefn..Ilelftaik was c hief-
y v u l l l g l l I U l l \ a u | . u ,l | | U B l l \ f l l \ ,u u u
c o n t e n t m e n t I n o u r l a n d o f t w o
younn:men lately arrived here.
namely , W illiam Hay do n and Rob-
ert Henthers,both ol'fmnllles
L I J U D U v a C a u u u .u p s u n u u | . \ u u n u u u
shoulders an d a ll that is behind
them! They broke the shell of some
sleeping thing In me.It h as c ome
to Ilfe.I c ould believe e1-ery tlllng
-» - - - »- - v - - .- " -- - " v - - .1 9 3 1 - Th e we e k o p e n e d o u t wi th
a ve ry libe ral run of c attle 11. 000
h e a d a n d tr a d e wa s ve r y d u ll a t
mlc es weak to 2511 lower than Fri-thatf calises evil, in the world, not U' addressed to william:
wickwness and not men.'".f'\}'}1§'arf!Qld People _gl \ny sshe
th at
g.I
even
whic h I knew and loved In Linc oln-
shire.They passed through amig hty s to rm ln whic h thei r s hip
was wellnlgl: foundered In the neu
and In eh lc h I arn to ldthou gh not
by him, that W illiam saved the llfe
of the well-beloved.famous Pu d -ta n Cu n t. J o hn Hu dd le s to n- a lif e
that Romeo and J uliet said to euc h
othe r at the Bla c k- fria rs' when we
went up to Lond on.God's o r wi t-
ness!I c o uld g o ou t a nd S i ng tothe moon."
"W a lt u n you're engaged,"sold
frogerr."Then :vpn hare a lic ense
l p - - - n v .u v . . - .- H w w w - _ " v u - - . - - __ -dey .Be s t steers he re bro ug ht
$8.65.Co ws a n d heifers a n d
sto-ckers and feeders were not f ar
fr om s te ad y .
Qu ota ti on s o n a C ttle :Go o d to
choic e y earllnes $7.50@8.60;fa ir
to go od y earlings $B.50@'l.50:
There is enough unaccustorncd mmsung ,,'"'°'"mamage?"trinmh there zo keep one thinking naked.One would suppose.our only thought was of :nntlmfor a long time.It xs especmlly am not n mfg'-
rtipenent today,when the old "GopdI I :§1¢e.gjr;a bqtterw
inntln nf munh~innl bnnuntinn is nnl than lurks and nlghtlngaloe.a ; ; a ; . ; " ;.§:'° i »;',;a ;;'ie' f;,';;m h u m they »~=»=the same wor th s u .as many »==g»<=~$033::;'m;".'?1:;';..,§;';:§';.'f='..';'L3 <==>=»f»==>== no fair yearlings $5.756
wh i t a n d wi ll b e n to un de r-ri g t to pigmaze?I cannot pu t non to kno w.L i k e a nel!-bred are better J ust nm# I rec ommend 8.50,trashy ,wa r me d - u p steers'F y ou .3?awa y my lo a nt s ilk a nd s atin a nd Enzliah srentlomen he wi ll o t ..-..ll ;...\|gs nnmns nfs-nnnd nhnlrun hnn rlv
stand why a strictly honest gov-
ernment ia so hard to attain.
Fadiiun Center Silk Dresses for
summer priced at $3.98 to $12.75-
alz es 1 4 to 5 2 - p la in and printed
fla t crepes and ch iffon a -p lainand printed Shantungs-sleeveless,
jewels and embroidery."
She llftcd her aklrt I IINIB, show-lng he r p retty nn kle s a nd 1 b lt ot
th e embroidery on her Dattlcont
an d : a v e th e perfumed u m a a
shake.1
w i p e y ou not like- the sound of
pourse dlsc la lm all c re dit fo r this
noble doing, but I wish hlm to rlseandgreetuam e r th e mu s t nu
dr1mk."
A l l clapped th d r hands and
lro ie an d dr unk the lo an .W lll lu n
than said, with A remarkable grac eof man ne r:"I have been tr y ing to
.___...._. .....- ._-..__.._. .
n luv.The young men sat und looked at
auch other and laughed
The final scene ln this little com-
edy of youth.old no human joy,
come n week after 1 lupper party
at M n .\Vlnt.hrop'|.W llllam
walked ho me with _the Lady Beesat nlne o'c loc k.Rus h lig hts we re
w g q o
sleera $'l,50@8.60:Zood to c holc e
he avy steers s1.2s@a.oo:n u r m
goo d s tee rs $6.50@'l.50:c o m mo n
m f alr be eve : s s.s o@s .so : g ood w
choic e smok ers $7.S0@8.50:f u lr
w good smokers $6.50@7.50: c om-
mon fn I nlr sbo c ke rs $ 5.5 0@8. 50;
tra shy mdex s s.o o@5 .s 0: go od no
choic e feeders $'l.00@B.00: fan- w
zood feeders $B.00@'1.00: c ommon
to I alr feed ers $5.35@6.0:stoc k
4
half n leevee , long sleeves-with and
wi th o u t jac kets.Eve r y ty pe o l
Si lk Dr e s s y o u n ee d f or mo rn i n g ,
a lt e mo o n o r n i g h l t
Children'a Shoe S li p p e r s - - Ovf o r d s a r e s tlll S f ln t th e F a s h i o n
Center.Mo s t a ll n i k e - - va lu e s b o
$8.50.l t
KENNARD RURAL
JOTTINGS
M r .a n d Mr s .Lo u la Go re ha m
a n d f a mi ly we r e Fr i da y eve ni ng
y irrltors a t Fran k Gas sers h orne.
Ma ds en Bros.,Ro y Ra lp h s ,Le~
my a n d L lo y d K u h r s p e n t S u n d a y
af te rn o o n wi th Ra y mo n d Ku h r .
Me n . W in c h e ll an d F r i tz an dJ o h n A r n we re Sund ay morni ng A
callers at the Frank Gasserhome.
Mrs.Catherine Jann and Ed
"Yes, but better the grace withwhich you wear lt and the smlle ln
y o ur uer ."q y"I llk e y oo l" sh e exc la ime d." I
am n in e to a s k o u r h o s t to ma k ey ou alt by me.ll' I wer e a queen
l' d hlre a poet to flatter me a l
Na r y d ld lt'| be tte r tha n wlne "
The blood ot both had re ddened
their fac es A llttla when s h e l mh i m
W llllam wa l as k ed to tak e Mis s
Brad e to dlnner . Hls s eat was nat
b e n .All s too d wlth bowed beads
wh lle M r Endic ott ma de a lo ng
pray er.Wllllam found another new
wor ld lu th e eyes o t the y ounz
ey el.He r abundant ha lr wa s
brown,Th e a k la o n her shapely
fa c e wa l talr b at tllle d wlth g lo w
Ing vltallty , her month c h armlngly
c arved. ber teeth perfec t.I t w a s
sold b y one wh o kne w h er at th at
lady .Th ey were brown,gentl rorget wa t m a e la u d e " .u l n wstorm at wh ic h th e beloved d oc tor
has spoken.I nm s ore that a ny of
- y ou would reac h out a hand to one
in tro ub le T h a t I shall ever be
rally to .do.But I wou ld not ha ve
y o u overestlmato me.Yo u wi lland me a po or hero hat, I hope, n
good cltlzen.I tha nk the doc tor
an d ea c h an d all o f y o u (o r th es e
welc ome jzood wishes."I n ma ti n g his ac knowledgments
Robert sold:"W e were shaken up
like dlee la a box and bad to pomp
I o r o u r llvea o n m a t ahlp.l ' m
pn mp ln g n ow a nd a n sc ar ed a s I
wa s then.I ' m alnttlng wlth em-barrassment an d gr a tltu d e Th e
ho ld ls n a l.A p u m a ls en ough
for a s amp le s o I sa y th ank y o n."
Th e /two speeches illu str atethe dl erlng methods ot the y oung
men..J ohn W ln th mp read a le tte r
Q..."
cows $4.o0@5.n0:sw c x neuers
$5.oo@e.o0:shock steer calves
$6.50@ 8.'l5:Stock heller calves
ss.so@'1.nn,
IIOGS DBCLINE SIIABPLY
Prices dropped 25@35c on practlcally all z mdes of 11088 Monday
and movement was d\lS8iSh at the
decline. Receipts were 13.000 head\ trading largely a t a mr e a d of
\ $5.50@ 6.40 and the high nrice ofrthe day was $8.50
FAT LAMB5 SELL HIGHER
Fourteen thousand fresh sheen
\
\
an d lambs arrived Mo n da y an d
me t with a br oad demand a t
prices strong hu 25c h lgher than
the close uf last week.Csllfornla
spnngers brought $10.00. fed wool
sklns $9.00 and sham lambs $8.25.
Feeder lambs held steady at $a.so
@'I,00 and ated sheep scarce and
l a p s were Thu rsda y §u pper gue st;
a t e Mrs . Geo . Na eve h ome.
M r s W m.c h a m.un n in g a n d lo n
' w e n Fr i da y mo r n i n g callers a t. n m . . . . . . . \ -n . . . . . - - . .\ _ . . . . . . -
time and whose wor ds ar e no w on
rec ord: "I have met the 'Lady Ben'
an she In called.She has everygraceoffo r m and feature.Ye t
her c harm L1 in something beneath
| . . | u u . |. m u u u a u l i a u e p u e r u .m l m u w r
o f t h e F i r s t C h u r c h o f S a l e m ,I n
w h i c h h e e n t r e n t e d t h a t n o a i u b e
m a d e o f d r i n k i n g o n e t o a n o t h e r
nga than lddigg a. new lin to those
w e rluu x ua un-c l: n umu.o _ur e au y proc lalmeu by u m A l.H n . F r a n k G a s s e r a n d ~iin$'§~JE.?1'§$i"En§'§3 at fesscuif mighty .A nu mbe r o f th ose pr ea-
'WEIB Suppl!!gue sts I t the LUIUE In l nnmnfhlnw unrw ln r ll f ih nt ti lt iKl'B'Ed th l t th¢l'0 WEN 8111]tfnchansed
Gfueham 11 Thursdn .Mr. and §¢"§§ Miller ninfo.. were
Sunday atm-noon vlmlton at the
éndxgw Chgutghun humq in _see
E-»»ie¢"}?`|E§5`1\d6&' ..;a Ii''Ei
md her frank good nature.Thellght ln her gmlla ll llke the Duggan-tlve glow p!_ qgrmln flowers not
enough ln the catalogue.//"I g y FAT LAMIBS: had lambs, goodTheysatlongat dinner with 'ln choice $8.50 6 9.00:springveulwnandwxmm r k m u m *" "* "lambs.:ood oo( choice s s s wllL'l°'If..l"..f}..f"f..?f."€'_£".1€Thn a m Bald:"You m y wma 1o .so : mi ns lnmbs hir w kwa
u r a n m n a unrmnennen wh o m m easy to explain."I ` " \ ¢ f " * " ' " ' * ' " " " " " ' u u a u u : u w hue | -be en s ic k fo r se ve ml d ay s.Itd s n o won d er . o n e wou ld lay .§ o b m l a t | 1 W D i m e
......_...._§.hut_ the ¥°'}"!'E mm 'W E lmpralgd twaen M.,»...?.?i"°w§:.h.,f.f.l"1",: . "° :Aga."
-I Am nat Ammi a w|¢ h| slnomas z abom umm s'z.'1a@
!yn and me lnnorann ol 8.251 cull lambs M.W@7.00.~ Lambs: feeder lambsw a n D r e u e a - n u t weat her de-|
ms n d l A ple n tifu l mp p l ol co olw n d l d z m e s m d t h s m i l " . C e n -
3 ; h a s 0 - h e l u - g u t u s o r h n m t g g
n c o - eu h p a n d n e w - \ n d t h e y w i l l n o t
f a d e -i n g ra ng e f r o m $ 1 tl;
oVn i le s a n d A n ,P m o t h le a -
t m ' e d | ¢ o n l y $ 2 l n d z e s 1 4 w 5 2 .
'f V lr g l n l lf a N a t u r a l B r i l l'
T h !ll u t m e n t i o n n t N n t n n l~7 ' - . vu ma d e b y B u r n a b y
1 . I t w h l c h d mc l l wu t h a
ot th u c xo wn of En lla nd .
lnd lc a lo Lhlt Gen tle W n h-
.mu h ave ma de a su rvey o r: m a n n b o u t 1 1 5 0 .A trac t
- o r p a u l o t u n d c o n t l l n l u 151
i tf i l. ln d u d ln g t h e Nltn ml b d d z o .
ju g n n l n d to T h o ma s J le d e n o n .
m y f f , r m . b y G u a m m o f E u -
nd ,or L h e mm o t * B O n h lllln n
. m d m d m m : m o n e y . "
ny n e r . md m e more nec nula neha d c a ms o u t o t n e n t ml- mmp to
n crude wlld er ue u.Th e y oung
lld y wn ln a me r r y mo o d n o t li k e
that of thu olde r fo lk a t th e ta ble.
Th e la tte r h o g ln n t o h m to d llc u l
th e vl x v d nruhlomz lh o uld th o
c r o n b o c n t o n t at th e k ln f l c o l-
o n !A l l l a t e d wi th Mr .n xd l-
c o t t t h a t l t w u l l y m b o l o t m -
dln t 0 ld ~ wol- ld lup o ntltlo n o u t o t
plus ln th a New wor ld .s u u m u y
we n a t th e mln d o f lr . W ln th r o n
tha t tho c olo ny should be careful
n o t t o o t e n d th o H u .The x°v~
a mo r quoted R o n :W llllnmn,of
tth o c hu r c h lt S ale m, wh o xu t th e
old lion, Endic ott. growladz" T h e n ll o n s n lp c c t ln w h l & I
c m u n o w i t h t h a t m a n o t : u h
n n d ln mo n tlb l a n p o llxd n f '
' B u y lp o k o u s o o f th a : r w -
lug ior tllleltlonn wh ic h wen to do-te nd th em a n l n n th a throat o f
fh a nrchhlshnn o f Oan wr lmry on
u k n e h n a a o x i b m
-- - »- - - - ~ v - - . ..comely bu t commonplnc a glrLW h lls th e d lnn u r wu g y mr ou h lr l.
W lnthnzg ohaarvod l l l l l l l m d
E l l n b c wi th deep I n d m w m x
m e s a
3 ,a t em, " nhc ma to no b-ert." A n t h e y n o t 1 p m- 1 Up o n
my wo r d l I t h i n k t h a t th e y U h
u e h o th e r .Th r ! n o n o o n e b u t
lh e m ld v n l.Th ey n o u t h a n
"'v'$&{i
u n walked wi th the 1 46.1B e la utter dinner,to r l t wo uld
m m th at they l l l l l h i d m l n :
d u n g ; to my I 0 mn o th e r .W h mm y returned.M n .W ln thr np m~
vlte d th em to e omo wlth Ro bert to
mg a t h e r h o mo 1 wo e ! I n te r .
I uh nll tr y lo ha ve d l the y ou u
peoplu c oma to meet y ou," sho mid.
' Y o n m l y count u m spa-dnl ln-dulgenee."
W lllla m a n d Rvb lr t wa lk e d lh o
bo u n d s wi th th e B n d l.n o w a l k
en de d a t th e lattlr '| d o or u ni gh t
v u n l l l n n .l n - n n u f .n» .. n.
: g lo w ln th e B r lf l t D lli u r .W o uld
ha c o ma ln n d a lt d o wn 1 wh lla ?
s m h e lm t h o d l n l o g m b y :
" I llk u ta he n :y on la i k about
t h a m n '
Hu n n xvmn d : " I n e ve r n w th a i :
be a u ty u n d! I c a mo ho n . "" A n they n o t u b u n l i f n l I n
mn g u u u r -
"Y u , b u t my u a l h xvo c h a n n d . "
" c h n n n d l H o w m y u m b o r '
A l sho n pokn | h |turned to h i m
wlth n lo ok o t ne ar es t.
"W o u ld y ou c a n to k n o w? "
" we lg s lg y l f e t l z u g u l m v m l -
"e n n er llngux-|
n h y l n l wi th m e lnc s o n he r
hx-aut.
" I th i n k u m I w lll n o t m u n w- '
Sho I -llhs d a nd loaned ln tu h l l
u n .n y l n x :" v o n m me burn-
mg wi th mr lo u lty I D G th an th r o w
eo d watu' on mo ."
| 0 0 4 w c h o i c e ;o.'l5@'1.z5:le ed -
s r la mb s fltlr to good $8.25@6.'l5.
EW E : F a t, lwd to c h o lo e 82 . 5 0
o w n ; h t ,m r t o m d 82 . 00 0
n o :c u ll md an n u m' e we s 8 1 . 0 0
02 .0 0.
' n n V l r d n l a .N e h n s h c h e m
n z m r y h u d u l l : b u a ln e a md u w
q w n m , h u a l m s m m e n m d t a r m -
en. n u otrerln u th e Dlnnt f or s ale.
Géo rza W e is s. the c h ee se mnk er
h u t n k a \ l > o d t i o n w l L h t h » P ¢ w -
nee Clty , c heese lnc wry .
Bly!-N!-fWork underway on new
county xhoul buildlng for district
five miie: nonth of hen.
' M u n c h - l h m u a m T n n a i e r
Co. moved to lu -get qunrtaen.
B n u f n o f m f h v n y No . 7 8 f r o m
3 Hn would.Tha ! ut llvvn log atha r.
The mm m;;.l.°°k°d ;Lla_ r~Ft.calhnunto Blnh-.¢hmnd.
c
\
--»THE ENTERPRISE-Blair, Ncbrnska. May 21. IPMa Pa r a Hn
MEN i'LooK"
ov||§ALLs
FRIDAY- SATURDAY
ON LY
SPECIAL
W 6
$1.so
GARRlSON'S
SHOES
Combine
Style - Service - Comfort
AT
1 :: \:
Phone32 or 33w .J . s A s s r o n n \
"The Big Store"
W. ~ Sas Table
of VALUES
'@
\
;| ~ ~ ~°
~\~, EJ ~0
£7
| ~
In Meats . . .
*W will find that after pe-~ ~
fusing our table of values ingroceriesvege-I b .l ~
ou will sub-
ct from your daily house~~~
nses.A hint on .
how to ve extra pin money ~
-shop at sam daily..|b_ |71/zc
Pot Roast com fed lh. l7%c
Hamburger ireshground l5c
Bacon sugar cured lh. - - 25c
Cheese Wisconsin full cream 20c
In Groceries.. .
Fig Bars nice fresh lh. = l5c
Corn Flakes .'§?él`°p»i§£25c
Coffee Breakfast lh. -= = 25c
Coffee hulk '1'§»2'l?.3 §Z§'i'iff 2.3¢
Soap Swiit's W"¥§..T$¥§"°39c
Wheatena Maltomeal
25c pkg. or Smax special pkg, 20c
Toilet Paper "°.?J",';'.i"56
Sugar Great Western 'Salk 59c
Rice hulk special 4 Ihs. - 25c
Raisins White l8c §"f§L'?' 25c
Pumpkin Seed b§}i'°lb.30c
Bread Betty Ann 2 loaves l5c
Flour Champion 24lh. sack 69c
Prunes 70 to 80 size3 lhs. 25c
Fruit Je||:..°..'ea..f.§;°¥1';z;':2s<>
Don Amaizo ,iii Eilifi 60c
Beets Nahorhood s,'2'§'iL'},'" l5c
/
" Q - : n r
if
or and undertaker, Blair.Office
phone, 161; res. phone. ras.e u
The Misses Rosalie and Beatrice
Foley spent the day last. Sunday
with their sister,Miss Vina at
Elkhorn.
Mr. and Mrs. J. P. Anderson and
daughter, Evelyn and Mn. J .P.
Anderson were Fremont shoppers
Last Thursday.
Regular $7.50 Permanent Waves,
$5 and $6 NOW.Either Croginole
or Spiral Wind.Phono 197.Mrs
K. A. Po nd.as-tl
Mr.and Mrs.Stanley Marsh of
Spiker heighborhood, vmre dinner
guests lat Sunday at the parental,
Elmer Frain home.
Mr. and Mrs. Lyle McBride and
baby were lost Sunday evening
supper guests at the parental,
George McBride home.
Mrs. W. T. Eppcrley, mother of
E. E. Epperley, is reported on the
sick list and not doing as well as
her relatives and friends would
like.
Doris Clare, five year old daugh-
ter of Mr. and Mrs. Charles Byme,
is sponding a couple of weeks at
the Grant Fergurson home at De#
ootur.
Mr. and Mrs.Floyd Evans drove
up from Council Bluffs Sunday,
and with Mr. and Mrs.Clifford
Halbert enjoyed a picnic dinner in
the country.
Mr. and Mrs. C. M. Christensen
and son, Clarence spent last Sun-
day at the Mr. and Mrs. Jens Jm~.
sen home, west of llorrnan.The
ladies are sisters.
The Royal Neighbor kcnsington
met Inst Friday aftemoon at tho
home of Mrs. George Nelson.A
good attendance was present and
a committee served refreshments.
50c Silk Stockings for Women-ncw low price 3Uc or 3 pair $1
every day in the year-all sizesandcolors-this is the standard
501: Hosiery sold by all stores at
50: a pair-but the Fashion Cen-
ter price is now 394: or 3 pair $1.
And another thing-G & J Tires
are the lust word in modern tire
construction. Ask about Sub-Tread,
Buttrcsscd Side<\Vall-perfect Hm
far ')RvA wr:gn AR ....|.in :mira
lumix, spent Inst snturuuy Qusw- uu-the J ohn T. Gallag he r h ome:
Re me mb er the B lai r hi gh s c h oo l
Alumni re un i on a n d ba n qu et, S at-
urday evening, May 23rd.18-St
The Baptist church ol this city
entertdns the Omaha Baptist Al-
sociation Tuesday, May 26th.
C. K. Beudorf, llcensed amtn1m~
of and undertaker, Blair.Omoo
phone, 161; rel. phone. 188.8-d
Silk hose mended or other line
mending done at reasonable prices.
Bring articles is J. E. Marks store.
18-2t'
Mr. his in-it H. A. Haack were
lust Sunday visitors at the home
of their daughter, Mrs. Byron Bunn
and family.'
Ralph Swanson and Ted Parson
of Omaha, were last Sunday after-
noon visitors at the John T. Gal-
lagher homo.I Dr.J.A.Curtis of Tecumseh,
spent Wednesday night, May 13 ah
the home of his sister, Mrs. H. A.
Haack and family.
For Sale-Three fsll Hampshire
boars weighing 175 pounds.Call
at Miller Munk"s blacksmith shop.
Leonard unk.17-tf
Ray Ca y of Kennard, section
boss ot' t North Western railroad
company/moved his family to
Blair thg forepurt of the week.
Mr. and Mrs. W. D. Smith and
nvu =.viu» #nw uunnul.ui eu nu-son.18-Zi
Ienora Gnuae of west of Or-nm.
spent last Friday night at the J. T.Gallagher home.
The Rebekah; held their resular
meeting last Tuesday night at. the
Odd Fellows hall.
Friends of Elzy King will be
glad to know he is much improved
since his recent illness.
The regular meeting of the W.
R. C. will be held at their hall on
Saturday afternoon, May ZQ.
|Mx-[and Mrs. Henry Hahsen of
0madia, called at the Chris Larsen
home last Saturday afternoon.
C. K. Bendorf, licensed embnlm-
er lid undertaker, Blair.Officephone, 161; res. phone, 133.3-ti
Mrs. Wm. Streclcfus ot Lincoln,
spent the week-end at tho home
of her sister, Mrs. Frank Dudgeon.
The McCarthy Progressive Club
imeets this (Thursday)afternoon
at the home of 'Mrs. Chester Aron-
'son.
Childnen's Shoes-Slippers-Omfordsare still $1 at the FashionCenter.Most all sizes-values in
$3.50.ru
Mrs. Ole Jacobsen and daughter,
Alice drove to Omaha Wednesday,
,May 13, and visited with Mrs. H.
0. Hurd.
The Busy Bee Club meets Fri-
Kenneth Hancock dl of Tekamah,\d'"Y aftemoon at the homa ol Mrs..were the out~of»town visitors at the
Frank Dudgeon home last Sunday.
Mrs.Margaret Iverson,Will,
Pearl and Vera Mae spent last
Sunday nftemoon visiting at tho
Oscar Thane home, west of Her-
man.Mr. and Mrs. Victor Jolmsonand
little daughter of west of Orum,
were last Sunday afternoon visi-
tors at the parental, Jack Crowdy|homc.
1 Miss Hattie Meierhenry spentSaturday night and Sunday at the'home of Mr. and Mrs. Walter E.
Meierhenry,who live west of
slay.Mrs.Elsie Carlson, Mrs.Ingri
Van Nay and Herman Abraham,
all of this city, visited last Friday
at tha Alfred Fear hnmn. who live
:Dollie Taylor, who lives in Dex-
terville.|Los A ladies' purse belonging
to Mrs.Harry Funk of Fremont.
:Finder please leave at The Enter-
prise office.18-lt
|Mr. and Mrs.Melvin Lawson ol
Rockport, Missouri spent last Sat-
'urday and Sunday at the parental,
F.,tf;man Tucker home.
Mr. and Mrs.Will Kuhr spent
last Saturday and Sunday at the
|Kenneth George home in Omaha.|Mrs. George ls a daughter of Mr.'and Mrs. Kuhr.
Spring and Summer Coats at BigSavings now at the Fashion Cen-ter--three special groups on sale'at $7.95-$9.'15414.'15)Sizes 14
tp 44-navy and black.l t
Mrs. Byron Bunn and baby, who
.\.......ter, Ruth Ann and Mrs.James
Maher were Omaha visitors on
Tuesday.
Mrs.James P.Sorenson and
son, Donald spent last Sunday alt-
ernoon at the C. R. Sutton home,
north ol Blair.
Mr.and Mrs. Walter Japp and
family of near Kennand, spent last
Tuesday afternoon visiting at the
Hans Wrich home.
Mrs. Reed 0'Hanlon is enter-
taining her bridge club this after-
noon following one o'c.lock luncheon
at the Robertson Cale.
Mr. and Mrs. J. W. Blatter and
children were Last Sunday alters
noon visitors at the home of Mr.
and Mrs.Henry Monke at Fon-
tanelle.
Mrs. Claire Warrick is enter-
taining twenty-[our little girls
this (Thursday)afternoon in
honor of her daughter,Maxine's
twelfth birthday.
Helen Wolford of Burwell, Neb.,
ls spending the week with her
sister, Mrs. Pierce Allen and Mr.
Allen, who reside on the Clyde M.
Allen farm south of town.
Dr.and Mrs.Earl Brooks and
son, Ben of Lincoln spent Sunday
at the home of Mrs.Brooks'
mother,Mrs. L. L. Lantry and
sister, Mrs. EI. H. Grinim and Mr.
Grimm.Mother:Cilroll your children in
a Melody Way Piano Club for the
summer classes begin June 2. Call
Mrs. G. J. Malmin for further inf
formation, Blue 244 or Dann Col-
lege.18-lt
Mr. and Mrs. Ole Jacobsen and
daughter, Alice mtertained the fol-
lowing guests at a seven o'clock
dimer last Thursday evening, May
14, Miss Mildred Kingdon and Ted
Miller, both of Omaha, Viola King~
don ol Kennard. and Al Marsh of
northwest ol'Blair.
Mrs. Agnes Long of Grand ls-
land, who spent a couple of weeks
with her daughter,Mrs. August
Walters at Walnut, Iowa, returned
to Blaulr last Sunday to .spend a
few days visiting at the Fred
Long homo before returning to
Grand Island the latter part of .the
muah
club met last week at tis Frank
Stewart home after dinner at the
Clifton.
Mr. and Mrs. Herman Kuhr ol'
near Washington, spent last Sun-
day evening at the home of Geo.
Kuhr Jr.
_Carl and Traney Bohs went to
Ainsworth, Neb. last Monday on a
fishing tr-lp.They plan to return
the latter part of the week.
Mrs. Emma Washburn has been
chosen a lile member in the Nebf
raskana.This is an organization
which includes professional people
and leaders.
Mr. and Mrs. leo-Hudleson ofLincoln,spent Wednesday
May 13 at the parental,
l-ludleson home and retu
Lincoln last. Thursday.
night,
Oliver'
to
The new pipe organ a Dana
College fumishes a sple op-
Portunity for musical i n t ctlon.
Call MTS.G. J.Malmi a
244 or Dana College for
mation.
Blue
infor-
1s-1s
Miss Elsie Petersen of Chicago,
who is a nurse,is spending a
month's vacation with her parents,
Mr. and Mrs. P. C. Petersen, south
of Blair.She was a guest at the
A.C.Debel home last Tuesday
night.
Mrs.Louisa Anderson, who haS
been staying at the home of Mrs.
Minnie Bugeon with her sister,
Matilda Johnson,while Mrs. Bu.
geon was in Kansas City, returned
to her home at Wisner, Nebraska
on Wednesday.
Raymond Hitchcock and his
cousin, Laurel llitehcock of Kan#
sas City,Missouri aillcd at the
Ole Jacobsen home last Sunday
afternoon.Mr.and Mrs.Tom
Hitchcock ol'Kennard,returned
home with them on Sunday for a
couple of weeks visit with rela-
tives.
Misses Hattie and Ethel Meier-
henry of this city, entertained tho
Telbasfa League last Tuesday
night at the H. W. Meierhenry
home.There were about thirty
present.The regular business
meeting was held followed by a
social evening.Refreshments were
mavund |..s.. :- ni...
,,m';,,;j££¢`sHa;§ ;€a:.""1
tal, Otto Allen home.
Hans Bornholdt was taken to
the Blair Hosplw Monday for spe-
cial care and nursing.
Pythian Sisters kensington will
meet Friday afternoon at tho
home of Mrs. Nick Thone.
Mrs. Esther Carpenter was on
the sick list a few days last week
but is improved at this vmting.
A. W.Rose left Tuesday mor-
ning for llxceldor Springs, Mo. to'
take treatments for rheumstism.
C.B.Johnson and daughter,
Evelyn ol Florence, spent the week-
end visiting at the H. J. Madsen
home.
Mrs.E .S. Beaty is spending a
few days with her sister,Mrs.
Ella O'Neal of Sioux City this
week.
Mr. and hks. Andrew Bohs and
family of west of Blair, were din~
ner guests last Sunday at tho
Oliver Hudleson home.
Miss I-lortense Halbert and Wm.
Gordon drove up from Omaha on
Tuesday evening and visit/ed Mr.
and Mrs. Clifford Halbert.
Mrs. Frank Simpson has been on
the sick list the past few days .
with an attack ofindigestion.She
fe; improved at this writing.
Mrs. Alta Wainwright, who has
been spending the winter with her
daughter, Mrs. Hall of Lincoln, is
home nga-in for the summer.
Mrs. Alice Rowe and daughter,
lrcno spent thc week»eml at the 1
Wm. Smith home at Calhoun.Mr.\
Smith is Mrs. Rowe's brother.
Rev. and.Mrs. A. Rasmussen and
daughters ol Kennnrd, were Sun-
'day afternoon visitors at the H.
Victor Rasmussen home on east
Colfax.
Cheer Cards, Thank You cards,
Congratulations,Birthdays,Sym-
pathy cards,Tallies,Place cards
can be found at The Enterprise
office.See our line.18-lt
Mrs.Minnie Bugeon returned
last Tuesday from Kansas City
where she has been visiting her
sons, Curtis and Harold, for the
past seven weeks.She reports her
I
I
Kr
.............-. vv---. ~..-...,,.......Gamble Store, Fremont, Nebr.l t
Mr. and Mrs. Raymond Hovcn~
dick of Omaha.and Mrs.Hugh
Sutherland and baby of west Ne-
braska street, were dirmer guests
last Sunday und spent the day at
the Ed Ilovcndirk home, south of
Blair.,
Mr. F. J. Keegan, who resides on
thc old l\lcPl\erson funn at De
Soto, wns a pleasant caller at The
Eniemrise office last Monday and
put his name down as n newmem-
ber uf thc big list of Enterprise
readers.
Mr. and Mrs. V. 0. Ireland drovn
---»-~---~~ - ---~~----»--- -~ »--ve ww swylng at me pursues.,nt Swnberg.H. A. I-Iaack home a couple of
The Misses Myrtle Short, Mary weeks,returned to her home on
Moore and Priscilla Rhoadea, whv the bottom last Friday.are attending school at Wnynml Pete Nielsen of west South
spent _the yveek nd with home street, ha, greatly improved his
folks "1 Blair.home by adding n very commodlous
'rea Lathrop is having the in~ porch which will be a great com~
tenor of his store completely relf°"t during the hot tllws of the
llccorated with paint und wall summer.paper which will greatly improvel Dr.and Mrs. J. V.Hinchmon
its nppearance.'left last Tuesday by train for
W'hyuotha.waDunrtpermanent|Gf¢'mfi€ld» Indiana to visit a few
that gives a natural wave?A real|W€0kS with relatives.Mr. Hinch-|
bargziin ntéli ~ "'ii'"§"€.T fqgj; Imanhhas ahrother and sister living
an .all rs..u er n a t t u t p u c mat 415 for appointment.46-cf]Hats for Women nnd Misses
Mr. and Mrs. H. C. Burnham ol
Omaha, came up last Thursday 00visita few days at the D. S.
Flaugher home.The ladies .aro
sisters.Sunday evening,Anhur
Rumham, and Mr. and Mrs. A. N.
Howe and Katherine and Edgar,
all of Omaha spent Sunday eve-
ning at the Flaugher home.Mr.
and Mrs. Burnham returned with
them that evening.
The young ladies'class of the
Bantist Snmlnv Rnlmnl wan .»\¢..»~.
..e..\. ...W ... ...e ¢.=.....5.How is your radio set working?
If not worldng properly, have it
checked over.When your car is in
need of repair you take it to an
garage.Your radio is the same,
it needs repair and tuning up too.
Leave your order nt The Enter-
prise office.In Blair Tuesday,
May 26.18-lt'
Mr. and Mrs. G. J. Maimin drove
up to Minneapolis and Northfield,
Minn. the latter pan of last week,
..~h..~. H11\u ..mm.l...z rnnninn nf
granddaughter,Verne Bugeon,
daughier of Curtis as taking
dancing lessons in New York City
and planning to 'leave June lst [or
Europe.
Mrs.Martin Bertelsen had as
dinner guests last Thursday, Mrs.
Alfred Comish and son Tom,.Mrs»
M. Andreason, Mrs. Fritz L. Carl-
son and Elsie Sorenson,all of
Omaha, and Mrs.James Sorenson
of this city.In the afternoon, the
above mentioned guests including
"__N.--\._¢..."__.-...tained Saturday evening at the
home of their teacher, Miss Graco
Smith.Those present were the
Misses Evelyn and Beulah Putnam
Helen Mclllillnn,Velmn Mundorf,
Fern Nicholson, Cqlletm Matteson,
Ruth Pate,Mary Louise Moran,
Lois Allen, Katherine Jenkins and
Emily Aronson.The evening was
spent in playing games alter which
a dainty lunch was served._
Saturday, May 28rd is BARGAIN
DAY ON PURINA FEEDS.Pu-
rina Pig Chow ls now selling at
the lowest price it has ever beenoffered, but next Saturday every
purchaser will receive an addi-
tional dlscount of 251: per bag.
This is yotlr chance to buy feed
and have the Blair Incubator
Company Hatchery help you PHY
for it.18-lb
MEN i'LooK"
ov||§ALLs
FRIDAY- SATURDAY
ON LY
SPECIAL
W 6
$1.so
GARRlSON'S
SHOES
Combine
Style - Service - Comfort
AT
REAsoNAnu: nucnzs
.»» =.Mrs.Chas.McBride,Mrs.c.R.
Sutton and Mrs. Babe Lundt drovn
ovcr 00 Kennard to spend the nf-
ternuon at the home of Mrs. Jnck
Andrenssn whose birth unhiver-
sary it was.The hostess served
nice refreshments Lo her guests.
Trapois Camp No. 1295 Modern
Woodman of Amerlax, invites the
public to n Ir entertainment nt
the M. W. of ~ Hall in Blair on
Monday evening,May 25th, at 8
o'c.lock.Moving pictures consisting
of 2 reels of Colorado scenery,
1 reel of Nebraska State Fmlr on
wheels and 1 reel of Harold Lloyd
comedy will be shown; also exhibi-
tion drlll by M. W. A. combination
team of Fremont, Nebr.Hon. H.
V. Reese of Berkley, Callfomla,
will address the meeting.The en-
terjzainment is free.F. B. Long,
Consul; T. H. Wright, Clerk.
where they attended a reunion of
all former St. Olufs choir mem-
bers.They were also in atten-
dance a t u music festival at St.
Olals College.Dr. and Mrs. E. E.
Popckc accompanied them.
A number of relatives and
friends guthered at the Hans
Wdch home on west Washington
street last Monday evening,Mny
18 to extend congratulations and
best wishes bo Mrs.Wrich,the
dum being her birth anniversary.
The evening was spent in visiting
and playing cards.Later in the
evening,Mrs.Wrich served A
lovely lunch.Those present were
Messrs.and Mesdames George
Wrich and family,southésst of
Kennard, .Kenneth George and son
Billy oi' Omaha, Wm. Kuhr, Otto
Kuhr, M. H. Miller and Mr. Chris
Wrich Sr., all of Bluir.
a'3:%; Special -2 - Dayssa s*
Time To Get Under The Straw
c o m m I N
%i: 2: The NEW SEAQX'
Styles and prices will please you
B i g g e s t V a l u e s
B i g g e s t V a r i e t y
In Suits and Fdrnishings
we have ever shown
and prices
J. D. GARRISON
CLOTHING STORE
BLAIR NEBRASKA
to Yutnn, Nebr. last Sunday and
spent the day with Mr. Ireland's
brother,C.J.and family.Mr.
Ireland is attending the state unl-
yerslty at Lincoln at present, tak-ing an economics course.
Mr. and Mrs. Charles Byrne and
family drove to Decatur Sunday
and spent the day visiting at the
Mr.and Mrs.Grant Fergurson
home.Mr. Fergurson who had n
stroke about ten days ago, is lm-
proving.Mrs. Fergurson and Mrs.
Byrne are sisters.
Baby Chicks every day.Barred
Rocks,White Rocks, Wyandottes,
Buff Orpingtons, Reds, Leghorns,
Brahrnas.All big fresh hatched
Nebraska Accredited.And bar-
gains in started chicks, too.Blair
Incubator <mpany Hatchery, Ne-
braska Acc edited.18-It
Austin and Bill Holler of Oma~
ha, entertained their parents, Dr.
and Mm W. M. Haller, and brothel
Ted as their dinner guests last
Sunday at the Phi Beta Pi fratere
nity where the are members.Inythe afternoon they attehded the air
Miss Dorothy Gray, accompanied1by Miss Wilma Pike, both of Fre-fl
mont, spent the weekend at tha
A.F.Gray home.They were
Omaha shoppers on Saturday.
\ Mr. and Mrs. R. M. Iverson and
f ly,who live on the bottom,
we last Saturday evening visit-
ors no the home of Mrs. Mavxégamt
Iverson, on north Walker a nue.
Mr. and Mrs. C. 0. Augustson
and daughters of Omaha, were din-
ner guests last Sunday at the Al-
fred N.Feer homei Mrs. Helen
Phelps was also an afternoon vis-
itor.
501: Silk Stockings for Women-new low prite 39c or 3 pair $1every day in the yen;all sizes
and colors-this is the standard
50c Hosiery sold by all stores at
501: a pain-but the Fashion Cen-ter price is now 391: or 8 pair Sl.
Mr.and Mrs Delmar Feer,
Lucille and Raymond, Herman Aly
raham all of this city,and Mr.
and Mrs. Frank Morrison of south
of Kennard,were dinner guests
'last Sunday at the Mr. and Mrs.
\H'"'fY Larsen home at Uehling.
I\
l
1
$1.77 and $2.77-all headsizes-all
materials-all colors-large show-ing of genuine Panamas, also spe-
cial group of straw hats at only50c each.Fashion Center.l t
The inteior of the Vinton Evans
garage is receiving a coat of paint
this week which greatly improvesthebuilding.The ceiling and
upper parts of the walls are in be
while with I-he lower walls grey.
50c Silk Stockings for Women-new low prite 39c or 3 pair $ievery day in the year-all sizes
and colors-this is the standard
50c Hodery sold by all stores at
501: a pair-but the Fashion Cen-
ter price is now 39c or 8 pair 51.
Mr.and Mrs.Tom Smith and
two ldren of Nashville, escaped
serio injuries last Sunday night
wha their car hit loose graveland
tum over, near Nashville.Tha
car 'as nearly demolished.Mrs.Smi is a niece of Mrs. Elmer
F 'ol this city,
Burman Gnyer drove up from
Gretna last Saturday evening for
an over Sunday visit with Blair
relatives.Ho hrought with him
ouita 1 hmm numhnr nl Mm mt.
<3
1
\\
rnccs at me municipal air pon.
Reduced prices on Chicks for the
month of May.Barred Rocks,
Brown Leghoms, White Leghorns,
Reds,Buff Orpinglons,Wynn-
dottes.All Nebraska Accredited
Chicks.There nre none better:
Bl.-sir Incubator Company, Phone
Black 395.Chas. E. Guydou, Mgr.
is-le
Lloyd Matthiesen,son of Mr.
and Mrs.Louie liiatthiesen,who
redde north o{ Blair, was s victim
of a pleasant surprise last Thurs-
dsy evening, May 14, the oecadon
being his birthday.About fifteen
relatives and friends were present
and the evening wus spent playing
ends.IAM in the evening Mrs.
llatthleaen served n lovely lunch.
Fire o l undetermined origin
broke out last Friday afternoon at
about 8:30 P. M. at the Hurry
Larsen farm home, west of Ken-
nard.The fire completely de-
stroyed the barn and several ad-
joining small buildings.The Kem
hard and Blair fire departments
were summoned when i t was
thought that the fire might spread
Ind burn the house but with the
no of neighbors and firemen the
Ere was extinguished and no dsm-'
use was done.Fortunately there
was no stock in the barn nt thetime, and little feed.The loss was
oovezjed by insurance.
I
I
I
1
Fashion Center Silk Dresses forsummer priced at $3.98 to $12.75--sizes 14 to 52-plain and printedflstcrepesandchiffon:--plain
and printed Shantungs-sleeveless.
haul! sleeves, long sleeves-with and
without juckets.Every type o t
Silk Dress you need for morning,aftemoon or night.,l t
The Coffee Club met last Thurs-day afternoon at the home of Mrs.
Claus Wulf on west I-'ront street.
There was a good attendance and
the usual good time.The hostess
served a nice lunch.Mrs. AugustRsthmann will entertain the Club
Thursday afternoon, May 28th.
Bnby Chicks started now will lay
ln October.Government reports
show s big shortage of eggs in cold
storage and s baby ehlnk mv cut
almost i n two.There are good
prices in might for poultry and
eggs.Pure bred Nebr-ash Ao|:re1
dited on sale every day now nt the
Blair Incubator Company Hateh-
ery.18-lt
Mr. and Mn. G. G. Hines enter-
tained at dinner last Sunday for
the following relatives and friends:
Mr.and Mrs. Art Purtell and
daughter,Betty and Miss Ruth
Hlmes of Scribner; Mrs. Grunt Fox
and son. Ted of Florence; lrlr. and
Mrs. John Hansllck and Llmlly ofOmaha. md Mr. Hnnsll¢k's mother,
of Chicago. and Mr. and Mrs. L. w.
La m o f thi s dw.
__,, _ __._,_ ..-...--_ -. ,,.,... .....for the rock pool at the city hell.
They are fine large fish and meko
he pool very attractive.
FREE BABY CHICKS are being
offered by the Blair Incubator
Company Hatchery ut their down-
town store.Saturday,May 23rd
has been designated as SPECIAL
DAY snd every visitor is given xr
chnnCe to win s prize.Every pur-
chaser gets something free as well
ns n big discount on all feeds. is-re.
Mr. and Mn. Fred Long enter~
tained at dnner and supper last
Sunday the following relatives,
Mt.and Mrs.Earl Walters and
children of `Jm¢'ksonville,Iowa,
Mn.August Walters of Walnut,
Iowa.Mrs. Agnes Long ol Gnnd
Island,md M r. l lld Mrs.1-:an
Clldwdl, southern o! Blair.
The following out of town rela-
tives and friends that visited dun-
ing the week at the Elxy King
home were:Miss Mnggie Lowe,
J. P.Stokes um Albert Bennett,ull of Hennan, Mrs. Nancy Sylvls,
'James Sylvls,and Mr.md M n
W. T. Meador all ol Fremont, MrsIElzy King Jr. of Teknmah,Mi n
ihlarguret Sfbwnrt,John Sylvlr
sud Cul Svoboda, all of Omnhs
-Ed Lenders o!.De Soto, Mr. Ind
Mrs. Tom Gosoard ol south oi
Blair, Mrs. Freeman Tucker, neu:
Blnlr and Mrs. Melvin Lawson oi
R°¢kD°r¢. Mlnourl.
|
I
oilet Paper ~°~, ,.,..°5c
Sugar Great Western '2.l'l£ 59c
Rice hulk special 4 lbs. - 25c
Raisins White l8c §"f§i?' 25c
~Pumpkin Seed »,§lf<"l»,, 30c
Bread Betty Ann 2 loaves l5c
Prunes 70 to80 slze3 lbs 25c
Don Amalzo |ier ».l.f. 60c
ets llaberlmod s,'l§'Z}.'}," l c
Flour €hampion 24lh. sack 69c
Fruit Je||:..'2'=e..:.§:°¥1':$i.'2 25c
°l o r sa a s
Be 5
Phone32 or 33w .J . s A s s r o n n \
"The Big Store"
'I
»£.x~\<L~_£
Blair. Nebrukn. Mn 21, 1981P»z=Sf?'- - 4 11 = =: s a u - a n
NEWSTH E KENNARD
Womens and Misses $6 and $6Dress Slippers priced to clear. at$2~65;Emu Jettick slippers u ealways$5 and $6--all size: and
styles there is only one Erma
Jettick and the Fashion Center in
Blair sell them.l t
judge four breeds, Holewin, Guern-
sey, Jersey and Ayrshire.A dairy
products rldsins content will also
be held in the morning.During Lhe remainder of the
morning,the visitors will be
shown through the dairy hams and
the new cal! barn.A guessing
.'~~1
WASHINGTON NEWS
Mrs. John Hadley and Mrs. Kate
Bnmum and son of Valley, paida short vldt at the Albert Suna
home Friday evening.Mr. and Mn. B. G. Shalier andfamilymovedtheirhouseholdgoods fo Irvingfwn Int Saturday
:here they wsu make their future
ome.Mr.and M m Martin Suuds
spent Saturday evening at the Jus.
Sunds home.Mr.and Mrs.Elmer Jefferson
of Casey,Iowa were weekend
guests at the W.B. Jefferson
home.Mrs.Hans Braesch is confined
The Senior class and their upon-sor, Miss Mn Burkholder, observ-ed lmeak day last' Thursday bytaking a Lrlp to the nate capital.They were taken in two' can dri-
ven by Glenn Ranenbaum andMrs.George Hedelund.Mrs. Ro-
senbaum also accompanied them.They le£t_here nbont 6 a. m. and
arrived at Davey, Neb. nt a quar-ter till seven when Virginia Zieg-
lu-'A mother, Mrs. Frank Timber-
lain had prepared an upperizing
brealdurt for them.Afoer break-
'fnst they journeyed on to Lincolnand went sightseeing through thecapitol, the museum, the penitcn-
tiary, the Sfxte hospital, Orthope-
dic kmspital and Gillen's 'land~
factory.They enjoyed a picni
dinner at Antelope Park and on
their return home stopped in Fre-
mont to eat supper and take in 1show.From all reports they ha~'a delightful as well as edneationu
trip.
Mothers Pension ws ;granted
Sylvia. Campbell and Une County
Clerk instructed to draw warrdms
for $20.00 per month for a perlod
of six months beginning June 1,
1931, bo pay the same.
By order of the Gounty Court re~
newal of Mothers Pension was
Spring and Summer Coats at BigSavings naw at the Faxhiun Cen-
ter--three special groups on sale
at 31.95.3916-slans.Sizes 14
za 44»-navy and black.xg
Fashion Center Beauty ParlorPhone 47-Alice Triplet if you
-fgranmd Sw a M. Miller for $13.33
Omaha,
Mrs. James Keenan of Aglingwn
was a guest of Mrs. Chu. Berryon Friday afmrnoon.
Mr. and Mrs.Lloyd Akin;are
busy mnving into Che house just
nonh of the Cashman property.Chester Rosenbaum in againseengokng about on crutdzes ashe had the misfortune of steppingon a nail one day last week.Mx.and Mrs. Clyde E.Buen-
bnum and childran were Sundayvisitorsat the A. D. Anderson
home,
Mr. and Mrs. C. L. RosenbaumandBonnieLeewereSunday
~AIBY FEED DAY AT battle an be seen at the Mllrllmlls Mmlmln Wilkins, labor¢w miles em 01 AMA. A vmum, Llbor 10.50 |21.00AGRICULTURAL comms N°l'59fY»oinnNebr.Also in Section 27 Allied Wemm Road Mchy.
~,1d.ny¢¢b¢h¢1 u»¢¢h¢Az=i-ey.
-- uml College in Hnwln W=d-A testimonial meeting win be
nesday, May 27, were received W held May 29 beglnning at 9:W
~onty Agent Geo. Bifu Wdlf- |n. m. at the Marshall Bros. Nur-
He is urging WUSHXDZVNI WlmfY|;ery naddnz shed out 0; Arling-
-rymell w attend the annw ,mm also, at 10:80 A. M. the some
moming at Anton Andersexfl
when we wlll attsmpt to explain
how other lnrmerg bothered with
noch pernldons noxious weeds
may eradicate them.judge four breeds, Holewin, Guern-I
,.-One of llho features o l :ne
day will be the dairy cattle
judging contest held during tho'
momlng hours.Conlutults will
s2.ao
18.00
ao.oo
17.50
2.50
9.00
26.50
15.00
.carried
that a duplicate for Warrant No.
2545 be issued, the original war-
mn; lmvlng been destroyed.
By o rder of the County Com
Mothers Pension ws ;granted
swPnelirdnaryannouncements_of nt the Anton Andersen farm ln Co., 1 Fresno
o program for the annual dmry Lincoln township, Wuhlnghm counA. N. Ballard, Labor
(John Hull, Labor
Ed Landers, Labor
John Barry, Labor
Hans M. Andersen, Labor
Jas. W. Nielsen, Labor
Herman Jungbloth, Labor
Moved seconded and
the O. C. Liesche home.
Clazence Busch of Omaha, waswlingon friends here Monday
afternoon.
BREWSTER BITS
were among those who helped DIlof Wolsmann celebrate his birth
day Thursday evening.'
Charles Voss and Alben Mo -
spent Wednesday evening-at E -Mat1.en's.Mins Erma Nelsen ntwnded thJgnior-Senior bgnquet at the Blai
~o~s.~'
Miss Madge Gaines,instmctnr
in music in the Kennard school forthe past year, was taken seriouslylll one evening last week und her
ather was called from Fremont to
e and get her llnss Gaines
o r t h e r e m a m ~ e r o e s c o o
y e a r .
0 \
|I I
OFFICE
'Price $3.00
They le£t_here nbont 6 a. rn. and
arrived at Davey, Neb. nt a quar-ter till seven when Virginia Zieg-
ler-'A mother, Mrs. Frank Timber-
lain had prepared an upperizing
brealdurt for them.Meer break-
'fnst they journeyed on to Lincolnand went sightseeing through thecapitol, the museum, the penitcn-
tiary, the Sh!-e hospital, Orthope-
dic kmspital and Gillen's 'Sandy
factory.They enjoyed a picnic
dinner at Antelope Park and an
their return home stopped in Fre-
mont to eat supper and take in ashow.From all reports they had'a delightful as well as educational
trip.
Let Your Local Man
DO IT!
v
Good Garage Service
at Right Prices.
Children's Sh o e s- S li pp e r s Ox-
fo rd s ar e still $ 1 a t th e Fash ion
Center.Mo s t a ll si ze s- -value s to
$3.50.1 t
Ne w sh ip me n t an kle le n gth Ch if -
f o n Vo ile Dresses,$2.95 st,th e
Fash ion Ce nte r- - all s i z e s - a ll i n
bea uti ful pri nte d eff ec ts.18~It
Fash ion Cen ter Be a uty Pa r lo r
Ph o ne 4 7- - A li c e Tr i p lc tb - - lf y ou
wa n t s re al pe rman en t g e t y o ur
Realistic Pe r ma n en t n o w f r o m
Ali c e- -ph one o r c o me i n f o r ap -
poi ntmen t.I t
W omens and _Misses $5 an d $6
Dres s S lipp ers pric ed to c lear a t
$2.65;IInns.J etti c k slip pers are
alwa y s $5 a n d $6~»all sizes a n d
sty les- "th ere is on ly one E n n o
J e tti c k a n d th e Fxzshien Ce n te r i n
Blai r -s e ll th em.I t
l a s h Dre sse s-- hot we ath er de -
mo d s a plen ti fu l su pp ly of c o o l
wash dresse s and the F ashion Cen-
te r has th c la r ge s t as s o rtme nt i n
W a s h i n g to n c o u n ty - e ve r y dres s is
crisp an d n e w - a n d they wi ll n o t
fa d e - p r i c e s ra ng e f r o m $1 to
$3.95 wi th n special gr o u p -
Voiles and Peter P a n c loth fes-
ture d at only $2 in size s 3. 4 to 52.
Mailing Lists
C6'unty mailing lists alpha-
betically arranged and in book
form for sale at
THE
ENTERPRISE
OFFICE'Price $3.00
11'L
WASHINGTON NEWS
Mrs. John Hadley and Mrs. Kate
Bnmum and son of Valley, paida short vldt at the Albert Suna
home Friday evening.Mr. and Mn. B. G. Shalier andfamilymovedtheirhouseholdgoods fo Irvingfwn Int Saturday
:here they wsu make their future
ome.Mr.and M m Martin Suuds
spent Saturday evening at the Jus.
Sunds home.Mr.and Mrs.Elmer Jefferson
of Casey,Iowa were weekend
guests at the W.B. Jefferson
home.Mrs.Hans Braesch is confined
x.p°Janice Gottsch spent Friday af~
ternnon nt the Ben Gottsch Sr.
home.Mr. and Mrs. Chris Sands and
Mr. and Mrs. Marlin s|.mdB Vldied
nt the Wm.Wiese home Sunday
afternoon.Mr.and Mrs.George Christen-
sen, Mr. and Mrs. Henry Christen-
sen and Mr. and Mrs. Louie GottschspentSundaysttheWm.C.
Christensen home.Mr. and Mrs. Edward Christen-sen and family spent Sunday with
home folks.
Mr.and Mrs. Alfred Nielsen
:md daughters and Mr. and Mrs.
Albert Sunds were callers ni theHenry Ticlgen home Sunday aft-
ernoon.Mr.and Mrs.Chris Shumakorundfamily were callers at theChris Stendcr home Sunday after-
n o o n .
Mr. and Mrs. Perry Glendenning
were visitors at the Fred Rnmser
home Sunday.Mr.and Mrs.C. V.Shumnker
and Mr. and Mrs. Gus Paulsen and
family spent Tuesday evening at
Short Time
Offer
..~°>
|.r
u u u u w v - - -r - -f n u m i s A 1 2 0 D l a f l n e d
§?"§2"5;;g's;¢;';f"¢L my de »»~»;==phone or come in for av- blara
hnrfmnnf.in m talk on steps of pomtment-1t month E"5f*=f'5=5i= ~ `55¥'f..*}'*L*a'..E.';..""$"...I'.'.°»5 °f....?"r.
nfo r s i x mo n th s mm H.. J.U.-. 'zi`§~ZJ1§§'==F £`aai|-,Q hand.`Gotham cola Stripe "Adjust-
Al. noon, lunch will be served in ablea"-the greatest stocking ln-an student nuvluu ww- ¥s!'!=*P=1¥'1s°.£'1s_=s°E':E'*.=2°i°"
~ve an-mn accmcnr nv. scnom one¢_0 ::ecT'`:|°n he ollonrd "dj°"'°"°d{da;fylgst week when she was acci-
ne ' 1 31.dentnlly hit on the hand with aGeorgeC. McQunrric,Ibambod pole with which some of
Counlv Clerk.;the_ children wex:e_playing.Her
so n dr o ve d o wn i o s e c h i m F r id a y ml.' V .
evening.Ray mo nd Gi lle tt is pnintinpf a
Mi s s B er th a Ma tz c n wa s a mo n g aapm hearing Ihr;words "I¥'rewstertheKe n n a r d Srmlnrr.:whn nn inu mI o..\...-s n=...tr l!a . . ....rl r .,.; .'department will have charge o! the
meal
Count)Agent Bates says the
afternoon program will prove in
teresting to Wne=hington county
people.N. W. Gaines is to lead
the group in stunts ahd reenea
tional games while the Perkins
family of radio Inme will also up
pear in :.\ short skit
I. D. Wood of the Axmcultuml
Extension Service will discuss tho
construction of safety bull pens in
zumllwr icnture talk while Prof.
Ilny lllorgun will toll local farmers
what influence three and four
daily milkings has en milk produc-
tion.E. C. Scheidenhelm will speak
on the progress in dairy herd im-
provement association work in Ne-
braska while H.R.Laseelles of
' n f l (Crowe o l the dair l"\'0l'y leg ns !|`l0\lKn mnne Y10Ul'UE(_lThe stocking every Woman has*hnned for is here now prieed atonly $1.95 in a real sheer chiffon
weigh*come in and see it.Fa-
shion (knu.-r.I t
Wash Dresses-hot weather llc-mnnds n plentiful supply of coolwash dresses and the Fashion Cen-
ter has the largest ussonment lnWashington coun '-every dressis
crisp and new-nn they will not
i`:nle-prices rnn from $1 tu$3.95 wilh n s cial group o lVoilns nml Peter Pnn cloth fen-tured at only $2 in sizes M to 52.
COMMISSIONERS'PROCEEDINGS
County Commissioners Room.
Blair, Nebr., May 18, 1931
The Board of County Commis-
sioners met pursuant to adjourn-
New shipment linltlg length Chif-
fon Voile Dresses,$2.95 nt the
Fashion Center-~ail sizes--all inbeautiful printed effects.181t
Fashion Center Beauty Parlor
Phone 47-Alice Tri ple tt-if you
want a real permanent get yourRealisticI'er1m1nent *now fromAlicephone or come in for ap~pointment.i t
Gotham Golrl Stripe "Adjust-
nbles"-thc greatest stocking im
vention since the gold stripe fits
e\ory'Ie;r as though made toordor.
The stocking every Woman has
hoped for is here now priced at
only $1.95 in n real sheer chiffonwclyzght--come in and see it.Fa~shion Center.I t
I T
. ;. -.H ,~ J .r x .~"E_.-lg .~' - j , .; F ¢ _ _ .
w ./~.1 .I 3 - l i i n . . . Z
f W a S p a r
varnish 1 ~ alnel
..,,,/ 1 ~-e l ~.161~, l s
." fit*"m e ~/
._ __ . ; f 4 '\ ': '
'r ~ _1
, Q ~ ~r'"
-~. . _ ."
_ ; : a ': . . 2 - - -f ~
Ev- °= '..~ -~
' " -_0uun n. . . ."' "
F1orhide'Enamel j
THIS special offer gives you
the materials to renewvarnishonfloors,woodwork
or furniture with clear Water~
S ar, or to "do" them over ingabriouscolorwithcolored
WaterSpar Varnish or Enam-
el. Purchase at quan of Water-
Spar with one quart of Flor-
1 hide (thc tough, tile-like enam-
el for floors and porches), and
SAVE 40¢o n the re gula rcombination price.Limited
offer - -c l i p co upo n no w!
N i c F n m n m c u s n u
t-lAtmWAnE
U u h » | | :l u l | | : » & v u
G O O D FO R 0 U . 4 0 c
- w h e n app li ed o n the 1.oml»i»
na ti on N h ! l i o f o n u s do a t h o f G / l n u s p l r u s d F l n l i d a .
A d d ao.. ........ .........................».................
N l - u m w a n
N
l l l l x
..........-....................g ||II
¢........................
Kennnrd Camp No. 1347 M. W.of A. will give a free picture show
at the I.0.0.F.hall Tuesday,
May 26 at eight o'cloek.The show
will consist of 2 reels of Colorado
scenes,I reel of Nebraska statefair on wheels, and 1 reel Harold
Lloyd comedy.National lecturer
H. V. Reese of Berkley, Calif. will
address the meeting.Everyone in-
vited, no cJ1arg~e.Fire of unknown origin com-pletely destroyed the barn andsmall maéhine shed on the Harry
Lemon farm last Friday afternoon.
Plans are now being made fo*;Memodsl Day services.Everett Cashman is the proud
owner of a new Chevrolet coach.
There will be services at the
Lutheran church Sunday, May 24
at eight o'clocic.Rev. Hans Niel~sen will deliver the sermon.Hans Svogerson,Harry andAlma were Sunday visitors attheJohn Johnson home.Henry Miller was among those
from around here who attended the
air races Sunday.Mr.and Mrs.Jim Sappenfield
vistiw at the parental, Jack Demp-
sey home for a short time Monday.
Mrs.Oscar Anderson and chil-dren ol' Arlington, were guests attheBert Swihart homg Saturday.
Mrs.Bert Hansen entertained
severaliriends at a luncheon lastWednesday in honor of her sonI)uane's first birthday.
Dr. W. E.Wright returned onThursdayeveningafterhaving
spent the forepart of the week at-tending the medical convention a~
Mailing Lists
C6'unty mailing lists alpha-
betically arranged and in book
form for sale at
THE
ENTERPRISE
OFFICE'Price $3.00
.H; 1
r?S*P!
lr* *
I
se n, Mr , an d Mrs . He n ry C hr i sten -
sen and Mr. an d Mrs. Louie Gottsc h
spent Sun day a t th e W m .C.
Christensen ho me .
Mr .an d Mr s .E d w a r d Chris ten-
se n a n d f a mi ly sp e n t S u n d a y wn h
ho me f olks .
Mr .a n d Mr s .A lf r e d Ni else n
a n d da ug hter s and M r .and Mr s .
A lb e r t Su nd s we re c allers a t thc
He n r y T i e tg e n ho me Sun day af t-
ernoon.Mr .an d Mr s .Chr is Sh uma ke r
an d f a mi ly we re c allers a t th e
Chris Ste nder home Sunday a.£ter~
noon.Mr . a nd Mr s. Pe r ry Glen d c n n in g
we re vi s i to r s a t th e F r e d Rarnser
ho me Sund ay .
Mr .a n d Mr s .C.V .Sh umak er
Ph o ne 4 7- - A li c e Tr i p lc tb - - i f y ou
wa n t n re al pe rman en t g e t y o ur
Realistic Pe r ma n en t n o w f r o m
Ali c e- -ph one o r c o me i n f o r ap -
poi ntmen t.i t
W omens and _Misses $5 an d $6
Dres s S lipp ers pric ed to c lear a t
$2.65;IInna.J etti c k slip pers are
nlxvzlys $5 a n d $6~»all sizes a n d
sty les- "th ere is on ly one E n n o
J e ttic k :i nd the Fxzshien Ce n te r i n
Blai r -s e ll th em.I t
\"aSl1 Dre sse s-- hot we ath er de -
mo d s a plen ti fu l su pp ly of c o o l
wash dresse s and the F ashion Cen-
te r has th c la r ge s t as s o rtme nt i n
W a s h i n g to n c o u n ty - e ve r y dres s is
crisp an d n e w - a n d they wi i l n o t
.fa de -pr ig c s ra ng e f r o m $1 to
e c -sc alp was c u t and it wa s nec essary
to ta k e f i ve stitc hes to close th e
wou nd.Th e Ke n na r d Rin ke y d in ks we r e
agai n vic torio us Sun day whe n they
defeated th e c hildren o f Na n c y
sc ho ol distric t 18 to 2.Th e g a me
wa s p la y e d at Ke n n ar d .
B e r t Leonard,wh o ha s been
wo r k i n g i n Counc il Blu ff s ,spent
the wee k-e nd with h is f amily h er e.
Mr .an d Mrs . Ola So re ns en an d
Mr . a n d Mrs . J a c k Dempsey tdrnvc
to Oma h a Sun day tq ta k e i n the
air rac es..Geo rge Hi l lm a n \ as a Blai r
bus in es s c alle r Mon da .
Mr .a n d Mr s .Elme r A n d r e a s e n
and boy s spent. Sunda y at th e par-
ental, A . D. An der so n h ome.
J o e Ga lla g lwr i s s p e n d i n g a f e w
d a y s h e r e w i t h M r .a n d M r s .
I s
1;in the east for the past two
months.Mesdames George Hodelund and*
H. C.Blaco nnd Misses Jeanette;
Hedelund and Ruth Brown wereFremontvisitorsSaturday after-l
noon.lMrs. Homer Ward and childrenand Mrs. E. Berry visited friends
in Blair Saturday nftemoon.
Mr. and Mrs, Robert Andreasen,_
Orval and Ruth Irene, and grand-
daughter, Delods Thurber drove toOmahaSunday to spend a fewhourswithMr.and Mrs.Will,
Thurber.The Kennard baseball team was
defeated 8 to 4 Sunday when they'played Benningtorfs team at Ben-nington.|
A large group of relatives andfriends came in last Wednesdnyl
evneing to help Miss Alma Svoger-1soncelebrate her birthday which`
oeeurred on that day.Miss Lavon Rosenbaum, daugh-~
ter ol' Mr. and Mrs. Greater Ros#
enbnum spent several days lastweek visiting her aunt and uncle,Mr. and Mrs. Herman Kruse at
Bennington.'
lllrs. Julian Jungbluth of near
Arlington, was a business caller in
Kennnrd Saturday..Officers of the Alumni Associ»
ation hnve been quite busy the
Epast week making plana for the'reception which will be held nt tholchurch basement Saturdn rening,Mr.and Mrs.Rn d é i y andchildren moved in Bluir the fore-
pazt of the week as Mr.Casey
will have charge of one of thn-
sections out of Blair,
Short Time
Offer
Q
.-f;f
¥r'r \g1\L
L ___
*'- 4 1 ~~
4
family spent Tuesday evenipg at
Vuilns and Pe hr Pan elatkf fen-
mmd at only sz in nlzeu M to 52.
Let Your Local Man
DO IT!
v
Good Garage Service
at Right Prices.
v
Kennard Garage
FRANK NAEVE, Proprietor
. . . _- - - - . - -.» . v v a u u l l v 1 . | | J u ; i : \ Is n e a k d a y W e d n e s d a y .T h e c l a s s
a n d t h e i r s p o n s o r e n j o y e d 1 1 s i g h t -
s e e i n g t r i p t o L i n c o i n .T h e s a m e _
d a y M 1 5 9 A l i c e M a t z ( - n w a s a.m o n g
t h e J u n i o r s w h o o n j o y c d : 1 w o i n c r ;
r o a s t .Ȥ
M r .a n d M r s .S o r e n W o l s m n n n .
nc nuol, UIBI.lu "lor Fil QS IIlonvmrI)eVinnc y to be pp t on J ae building
i n th e n o m futu re.I t i s n me m-
onto o f the bninnco o f the f a i r
mon ey earned by the pupils In s t
full.Tho pic nic uuvats wore troznt-
od wi th Mi lk y W a y li a r s f r o m th o
sumo funrl.
L
4i l i a n s a s C i t y w i l l a p p e a r a s a n 3 d ' | m c n t t a k e n M a y 4 ,1 9 3 1
l '= § ; n vn l n r \ n Y 'r n l l)-... n».»l¢m a l M D IQ R
Washington county dnirymen
wishing'progmms can get them nh
the County Agc»nt's office.Be sure
to hcnr the talk on hull pen cnn~
struction,for we need more of
them in Washington county.
Spring and Summer Coats at Big
Savings now at the Fashion Cen-'e'~;"::¢¢.§»1€°f"1.s£e"PS.v"sale
Blucn and Chris l-Iinz.The minutes of the preceding
meeting were read und nppmved.
Alter a mreful cxnmlnution ol
the following hills on the different
funds, it was moved and seconded
that the following claims be allow-
ed, and the County Clerk ordered
to draw warrants on the funds i.n»
dicated, to puy the same.Carried.
I n u r n..1|vu n Dvnf Qm,..-..-.....,,......-A ldnnlr
$1 `17?`Im.\"§-;s ':'z;§{ifi.»}]}i§i¢§»I` ;.1iY . . .- \ .1 -v u ... H . » » . - 1 --m a t e r i a l s - - a l l c o l o r s - " l a r g e s h o w -
i n g o f g e n u i n e P a n a m a s ,a l s o s p e -
c i a l g r o u p o f s t r a w h a t s a t o n l y
5 0 c e a c h .F a s h i o n C e n t e r .l t
G o t h a m G o l d S t r i p e " A d j u s t e -
ab les " - -th e grea test stoc king ln-
ven ti on s in c e th e go ld stri pe - -f its
eve ry le g a s tho ug h mad e too rde r.
'I"h¢stoc king every W o ma n has
hoped f o r is here n o w priced a t
011i_y 51.05 i n n real sheer c hiffon
we i g h t come iz.and see it.Fn -
shion Center.l t
N E B R A S K N S B I G C O U N T Y
HA S O NL Y 1 , 4 0 1 F A RMS
'3Nebrasim's largest c o unty , Cher-
ry whos e sp ac i ous distanc es c ould
swa llow up th e 'states of (,'onnee'
tic ut, De laware and Rh od e I sla nd
ii i on e gu lp a nd lea ve the D is tr ic t
of C olumbia for dess ert,ha s on ly
1,401 fo rms, b ut, be li eve ua , th ey
are no bac klot tmc k patc hes. There
L .C.Cooksey ,Bo ok n e -
pai rs
Oma h a Sc hool Sup ply Co.,
Supplies
I. C. Elier , C ou rt Cos ts
Ci ty o f B lai r , L ig h ts, etc .
»K-B Printing Co., Supplies
Mrs. J osephine Carter, Poor
E d Mu nd o rf ,Poor
J .E. Hoven dic k, Po or
Mrs . C . A . Hou ghton, Po or
The o. Lar sen , P oor
Stewart Pha rmac y , P oor
G. C. Mc Qunrrie, Stamps. etc .
W ards Cash Store, Poor
K-B Prin ting Co ., S upplies
Far me rs E le vator , Po or
Mrs. G. C. MeQunr1-ie, Correc-
ti n g papers
Lester E.Belforul,Expr ess,
etc .
Potndle Bros., Poor
Lester E. B elfor d, Mi leage 105.1"f
Mrs. Marie Pedersen, Poor 10.00
4.50
19.80
97.30
63.07
30.31
8.00
1 .50
20.00
31 .00
10.00
1 4.95
47.36
30.55
21 .20
1 1.75
19.04.
19.11
39.50
I II!
sare s14 of them Qvér 1,ooo a m w e s p f i a r c u s I g .C . D . C . ,C o u r t
l n f' A n * n ~l u g .l l l L u t h ,L H C u \ \ : | a | » § , \ :a u n t v u a b u \f a r m i n f " l 1 n 1 r v n n i l n f u i n 9 R 1 0 4 M n r m l a H ¢ ! ¢ ' ! l ( . " ' I C . I ) . C . ¢C O U f t
you see, does not mnke a distmc
tion between a farm and a ranch
they are all farms to the enumer
nlfors at Washington.There are 3881 488 acres of
land in Cherry crnmty.Remember
this county is approdmulely 96
miles long md 68 mnles wide with
an urea of 5,986.7 square miles
within lm borders.What *land is
not mknn up with lalms is convert-ed lnlo drop l m l Lnd cattle
ranches. The cmp returns are 'not
c°§f-»Mrs. John Watkins, PoorThe Enterprise, Legal Prln-
tingFred Guyer, Stamps, etc.
Lincoln School Supply, Sup-
plies
Soldlers Rellal Com., Relief
Louis C. Inrsch, Dragging
John J. Fitzgerald, Dragging
Wm. Sievers, Supplies
Edward Vizina, Labor
Evans Bros., Dragging
B. A. Gottsch, labor
"";."'T;.;`r.a..;a'¢;;.;;. IQQQQQ1.
wru imnressivn 1.042.883 bushels lice Line Transfer, Trucking
199.10
moo
12.9 1.
89.75
83.31350.00
86.45
22.50
1 .75
12.15
12.7516.67
1.1
of corn, 866,459 bushels of oats,51,480 bushels of wheat,63,546
bushels of barley, 154,924 bushelsof rye, 80,688 bushels ol potatoesand 380, 545 tons of hay in 1929
but 214 |30 ge cattle most of
ranches, besides 8,813 cows :Ivins
milk.
Spnng and Summer Cont; at BigBavmnow at the Fashion Center-ifree :medal errvupa nn sale
at $1.96-$975-$1L'l5.Bi n! 1 |
to 44-navy and black.iz
Fashion Center Beauty ParlorPhone 47 Alice Triple"if youwanta real permanent get yourRealisticPermanentnowfromAlice-phone or come in for ap~
polntmeut.1!
Rey M. ohm, Labor '
Arthur Gottsch, DmszinzJ. W. Snodderly, LaborHenry A. Knlep, Dragging
Fred T. Puls, DraggingJ. E. Jungbluth, Dragging,
etc.Perzy C. Tucker, Dragging
Fulton & Millard, Grading
Geo. Enyeart, Labor ,
Herbert Jones, Dragging
Axel Hanson, DraggingJohn Barry, Labor
Marshall Wilkinl, DraggingJohn Schultz, LaborDan Greeno, Dragging
Geo. Enyeart, laborA. A. Wilkins, DraggingA. N. Bama, labor
John Schultz, Labor
fbemv;hite faces,were'on the
.`>
nnnnnw nm.m1A'l'E KNOCKS.Iauia Schenk. Labor
200Frank J. Wolff, Trucking 60.00
49.50
8 1.501.5048.60
28.80
74.5010.75
15.90
1 1.10
28.408.5021 .60
9.004.059.00
as.oo
83.8015.9015.00OUT CANADIAN THISTLE Rullahd Warrick, Trucldng s.oo
Jas. W. Nielsen, Dragging 18.00
The longest prize fight in the Aug. E. Echbankamp, Drag-
hlmry of Washingwn county hu sim:,44.00nm finished.lt beszan one fmsty Nicholas Oil Corp., Gas 121.44
»-- -~--. ._mnmlnz on Odaber 14 lut fall Frank 0. Swmiwi.`uhm ml and unvhal! pmmdl ol wqmf E. lierlerhmry, Dn|. "
xxgnlmg nwm......................matched wizh each square rod of
stubborn twenty-one year old Can-
nadim Thistle.On Saturdny mornink, May 16,
the rderee announced u knockc-:t\
blnw ndmininered by sodium
chloraw.The promoters of Canm
dian Thistle no anions for un-
arenn of tha abovemmdonvi
other bout with K. 0. chlorate m
bl staged at some other qhdum
in wuhinnrwn county. wwrdinz mOmmty Ag mt n m. o l W llh i l r-
inn Cmmty.The : u n d and blo od mute d
uirfick Impl.co..on, etc.
E. E. Entxekin, Repairs
Chas. Rogert, Dragging
Gene Freeman, TrucHng
Menno C. Larsen, Dragging
howls Grimm, Dragging
Shirley Stokes, Labor
Draszinz
oe.lk D
Emil Jensen,
Mrs. Hannah T e,
sine:
N. A. Rogert, labor
J. E. Rogert, Iabor
Chu. Ragut, hbor
a H. Neff, Labor
Hnny Tucker, Labor
rag- '
22.81
.50
14.40
a,oo
2925
12.60
18.50 i
99.55 l
25.6512.Wmooao.oo26.0010.00 1
\
" I l l "1
»w,-.-»--).
--THE ENTERPRISE-3.Blair. Nebraska, May 21,1931
mont, and Mr. and Mrs. Art Luke:
shared honor: at a birthday cele-bration held at the Wm.ScheerSr.home on Thursda evening.Cards were played ml ' a social
evening enjoyed after whlch re-
freshments were served.Thosepresentincluded the families ofMessrs. and Mesdamevwm. ScheerJr.,George Scheer,August 1-kb.
wnkalnp,Arthur Laaker,Ernest
Merkling and Emil Scheer,md
Miss Wilma Scheer.
Gotham Gold Stripe "Adjust-
ables"--the greatest stocking in-
vention since the gold stripe--fits
every leg on though nmde to order.
CRJOW ELL HOME
M:~=.Biusings was very glad inhave her san and his wife call on
her Sunday.Mr. and Mfg. Lloyd Smith and
Womens and Misses $5' and $8
Dress Slippers prlced to clear at
$2.65;Enna Jeuick sllppen aredways$5 and $6-all sizes and
styles-there is only one Emma.lettick and the Fashion Center inBlair sell them.1¢
Advenise in The Enbervrlse.
HILLSIDE NEWS OF
GARDNER DISTRICT
Mr.and Mrs.Allred Anderson
attended the air races in Omaha
Sunday afternoon.
Mr. and Mrs. Pens Ciausen ac-companied their two sons, Leo andAndrew to Fremont Sunday alter-noon to visit Pheir daqghter and
Wash Dresses--hot weather de~mands a plentiful supply of cool
wash dresses and the Fashion Cen-
ter has 'f-he largest assortment in
Washington county--every dressis
crisp and new--and they willnot.
Mr s .George Olin ge r o f Mod ale,
Io wa .
Mr . an d Mrs . Alf re d Ha n se n an d
c hildren spent Mo n da y eve ni ng
wi th M .O.Ha n se n o f Ke nn ar d,
helpi ng h im c e lebr ate his b irth day .
Mr .an d Mr s .Char lie Sutto n,
»
evening at the Neum Warrickhomevisiting with Mrs.LoftinSteuart who left the latter part/of the week to jdin her husband.who has been transferred bo Pitts-
burgh, Penn.
Mr.and Mrs.Gene David andchildren visited at the Will Selt:home Sunday evening.
I
ci~ g'r~up of straw hats at only
50: each.Fashion Center.xc
.5 i ~.L |.hoped f o r i s here no w p ri c e d a t
°=\i.v $1 .95 in a real shee r c hiffon
wesght so me in a n d se e i t.F a -
shion Center.11;
Ha ts f o r W o me n an d Misseh
$1.77 and $2.77 all headsizea-»-all
gn a te r i ai s -g li ¢o lo r s - la r g e s h o w-
rs.Walthill Sunday to vizit with Mr.
and Mrs. D. D. Day.
Mrs.Major and her children
came down from Tckamah Sunday
morning to spend the day with her
mother and aunt.They brought
their dinner with them and enjoyed
it together.Miss Anna Martin conducted the
services l1ercfSunday, which were
enjoyed gre a y by all who at-
tended./
Mrs.Lloyd'p niece,Mrs.RuthCoupland came from Elgin, Nebrf,
w spend last Thursday with her.
Mr. and Mrs.Huff o! Council
Bluffs, and Mrs.Marita 01 Bur~lington, Iowa atopped to see the
Home Sunday.They visited with
Mn. Lloyd,who was the room
mate o! their aunt, "Aunt Sally"
as we called her.Misses Grace and Blanch Hill of
Blair, came up to see Mrs. Hall
Sunday evening,bringing her
some flowers,which she enjoys
greatly.
Mr.and Mn. George drove to
Ute, Iowa to conduct the lunew
services of Mr. Perlcinn, which were
held last Wednesday.
Anna Buchan Stuart was born
in Ayr,Scotland,Dec.17,1835,
When threg years old she, with her
parents went to Canada, where she
grew to womanhood.ln 1859 shewas united in marriage to Peter
smwan.In 1868 they came tntlie
United States and settled in Orum,Nehr. on a homestead.This was
their home until 1880 when they
came to Blair just 12 years ago
last Sunday she came to Crowell
Home.Two children came ia bless
and make homg life happy.One,
George P. passed away in March
1928 and MJD.Nellie H.Smith,
who her home in Blair.lilrs.
Stuart sought to mature her spir-
itual life in the Congregational
church of which she was a life
long member.She leavestomourn
her loss besides the daughter, Gve
grandchildren,and a host of
rieuda.
children.
Mr . a nd Mr s . Rob e rt Ra s mu s se n
an d f a mi ly we re Sunday dinner
gu e s ts a t th e F r an k J ah n e l h o mo .
Mr . a n d Mr s .Ha r r y E r ve y a n d
Fa y e an d Mr. a n d Mr s . J . L .Pet»~
ersen a n d Ro b er t vi d t e d a t th e
C la r k Stri c k le tt ho me ne ar E l k
Ci ty S un da y a fter no on .
g |..|.. .
crisp and new-and they wlll_no!.
fade-prices range from $1 to
$3.95 wilh a spevlal group ofVoilesandPeter Pan cloth fea-tured at only $2 in sizes 14 to 52.Womens and Misses S5 and $6
Dress Slippers pdced to clear at
$2.65;Erma Jettick slippers are
always $5 and $6-»a11 slzes andstyles-there is only one EnnnJettick and the Fashion Center in
Blair sell them.l t
Mr. and Mrs. Hazen Marshall vis-ited at the Ches Sutton home onWednesdny.
an d Vir g in ia An n were Sunday
dinner guests of Hans An derson
and daughter, Flora of Omaha.
Mrs. Rudolph Mencke and daugh-
mr . Gr cu h en w er e Sunday dinner
guests of Mr .and Mr s .Detlof
W olf.
Mr. and Mr s. Louie Mcnc ke and
children spent Sunday afternoon
vi s i ti n g Mr . a n d Mr s . Ha r r y L a r -
son.J .J .S mi th o !Oma h a ,wa s a
Su nd ay dinner gu es t a t th e Geo.
Bu dg er ow home.
Mr. a nd Mrs. C ha rlie Ha sk s pe nt
Su nd a y a fter n oo n a t F re mon t with
Mrs. J oe Genoway und c luughtr-r.
Mr s. E. C. Li pp i nc o tt nn d Ru th .
Mr . a n d Mrs . Clark L ip pi nc o tt a nd
dau ghter,Mr. and »Mrs . Fred Pec k
and C ly de Carte r vis ited at th e Ted
Oli ng c r h ome Fr i da y even ing.
Mr s .A u g u s t Sc henzel an d son,
o f Fr emo nt, vis i te d a t th e Hu r r y
S mi th h o me Mo n d n afte rno on.
Cly de C arter .of 1c Geeh¢:e , Ark.
an d W a lte r Pec k spent F f f g
ni gh t wi th Mr . a nd Mr s. Fr e d P
un d f ami ly .
Mi s s Ma r th a Ha i e r sp en t th e
wc ek»end vi s i ti n g a t th e Charles
Ko e ni g h o me .
Mr . a n d Mr s . Te d 0 E n g c r \ \ c m
Mn.0.H.Godxey,secy.,mdMm.RouPa rrlxh.f.reu.Mr.f`&'»,"'§a "gg gelms mc~
eompsm y rs.drove £0 Omaha Monday.wi'Z1'l
there they vidled Mr. and Mn-Howud Grahdon.*
The Herman schools closed Fri-
day,May 15 with an nil-schnolpicnic in Mead park.The weather
was pleasant and a large numberofpatron:attended.There wasan abundance of gqod _things w
Society which met lt Lhe hall for
quilting Wednesday afternoon.,.
While in Lincoln last week Mr.and Mrs.H. B. Cameim attended
sessions of Grand Chapwr, O.E. S.
children spent Sunday at Lyons
visiting at the borne of her par-
ents, Mr. and Mrs. Oscar Beck.
Guests at the Fred Rogert home
Sunday were Mr. and Mrs.Pun!Taylor of Omaha,Mr.and Mya.
the Alumni reception held at theLegion hall Fri ay evening, May15 for the class of '31.Mrs. A.H.Lowe welcomed the class; Wendell
McConnaha responded,and somemusical numbers made up the pm-gram while they were seated atthe tables.Afterwards they wentto the hall above where two shortplays were given.The rerpaindcr
.5 |\ : ....re tu rn ed to spend th e surnnfer
vac ation at h e r h o me h e r e .
Mrs . B ert Ro man s, who ha s b een
ill f or s o me ti me at h e r h ome e as t
of here, is reported better and able
to s i t u p s o me o f th e ti me .
M1-5 and Mr s .B e r t L o we a n d
cllildrian a n d Beatric e an d E ve ly n
ped of! with plenty of iw cream
furnished by the school board.
Ther; wen games and baseball inthe ball park.The ball park wasrecentlypurchasedbythetown
and added to the park.
HERMAN NEWS
Mrs. A. W. Barge spent xeversl
days last week in Omaha, Waiting
her son. Harold md wife.
The lot north of the Hermanfilling station hu recently beenfllld in md lev eled.Grass need
hu been sown and shrubbcry setout which nukes it a more M -dve lace.pThe Senior chu had their pic-
h u u taken in their caps andgawns at Blair Thursday.Mr. and Mn. Raymond Kaatleand children of Columbux, Nehr.,
spent the week-end with Hermanrelatlves.Misa laulse Larson,who has
been Mmching in the school~ al
SUNDAY and MONDAY
MAY 24 and 25Sunday Matinee x
Honor Among Lovers
With Frederic March and Claudette Colbert
Accordion Joe-TALKARTOON
Why Continue the Struggln FOMEDY
FOX NEWS
op pee |With Joe E. Brown, Bernice Claire and .hck Whlllng
COMEDY-Dance Hall Marge "-
Home T heatre
HomeOf Pe;/'ccl razkmg Pldures
ington, visited Friday at the Wm.
Brandert home.
Opal Hansen ot Blair, Mrs. Hu-
old Webster and Joyce,Harley
Ragert and Wm. Cram.
John Lowe of Waterloo,Iowa
came Sunday and will visit here afew days.
. . ..
Mrs. Berihn Lowe home.
Fnends here have received cardsannouncing the marriage ol MissFrancesHe no g o l Ins Angeles,to take place June `10.Mr. and Mrs. Guy Bennelthnve
moved into rooms at the Mrs. Josie
Hart home vacated recently by Mr.and Mrs. Emil Follen.Miss Ethel Doves of Fremont,formerly of Herman, attended the
Alumni reception Friday evening.
The out ol town teachers left the
last of the week for their homes
to spend their summer vacation.Mr. and Mrs.Frank DeVry of
Fremont, visited at the o. 1. ml-
singer home Thursday.
Dr. and Mn. A. J. Cameron at~
tended the Medical convention at
gnnhn last Tuesday and Wednes-
y,Mrs.Anna Peddie and MissCarolineWachteremermmedatdinner Sunday, Mr. and Mrs. Ju.
Neilsen o l Omaha,Mrs.Tillie
Wawter,Mr. and Mrs.Gilbert
Olson, Rosemary and I/eo Hannnn
and Hans Andersen.Supt.and Mrs.Shrader aremoving from the Burdic home into
the D.W.Rutledge residence
where Mr.and Mrs.Buch have
been living.
West street south from Fourth
to Fifth street has heen given acoat of gravel.
Mr; and Mrs. L. A. Woodward
spent Sunday at Omaha nt theAlben Woodward home.Alberthas grading work at Sheridan.Wyo. for the summer and the fam-ily will go there as soon as the
Omaha schools dose.Mr. Wood-
ward is already in Wyoming.
Mr.and Mrs.Arthur Metzler,Cwle s Metzler,Lloyd and BahMetzler, who is in a hospital fol-lowing an operation last Monday.
They report him improving.
Ross Deets of Blair, called onHerman relatives Friday evening.
Mr. and Mrs. Pad ;l`§lor ot
Omaha, vddted at 9-he F Bogart
home Sunday.Mrs. Harold Web:
ster and Joyce went horns withthem that evening and will spendtl\e.week in the city.
....¢
TUESDAY
MAY 26Glassware Night
~a~ ~re~
FRI DAY a nd S ATU RD AY
MAY 22 and 23
Saturday Matinee
Silver Horde
With Evelyn Brent and Louis Wolhelm
Red Riding Hood Cu¢mn-Pnthe Review No. 45
THURSDAY
MAY 21
,..._.._.._..
Special for /1
Friday and Saturday
o
Lexington Cream Flour 48 lb. bag $1.09
Snowflake Flour 48 lb. bag ' - $1.09
Mary Ann`Flour 48 lbbag - ' - $1.09
Kellogg; Corn Flakes 2 large pkg.25c
Post Toasties 2 large pkg.--- 256
Rice Flakes 2 pkg.--*- /_251:
Omar .lar Queen Olives ---43c
Large Bottle Vinegar -'--°l5c
PHONE 113 114
North Slde Store
bunde of Bt. Paul, Mlnn., GeorgeHineline and wife, Edna Parken-
lng and Mrs. Ted Klahumle mdchildren of Blnlr.
Dave Gustin and family wereSunday vislwrs at Henry Baker?
birthday dinner in Blair.De Soto school will close thisweek with a picnic Friday.The fnllov-ing children received
their eighth grade diploma here
this year.Sylvia and Virgil Hine-
line and Marjle Sellz.
'=».~....
BENCH NOTES
Mrs, Ches. Sutton, Mrs, Theodore
Lundt and Emma Lou and Mrs.
John Sutton attended a birthday
pmy Thursday aftcmoon at [.he
visited lenrnl dnys last we¢k wiihher mother, Mrs. Frmk Bmwnandfamlly.
Mr. and Mrs. Lars Jeppesen and
Bobble were Sunday altemmm via-
itars at the Mrs. Gertnude Nelson
home south of Blair.
Robert were Wednesday dtemooncallers at the Rollnnd Smith home.
Mr. and Mrs. Ruben Rasmussenand family spent Sunday cvenlngat the Jens Sorensen home, nearOrum.
home.
Mr. and Mrs. Davidson and babyof Missoud, were weekend guests
of Misa Eda Sierk.|
The }N'pmen's Club met .jvith
Fashion Center Silk Qresses for
summer priced at $3.98 to $12.75-sizes 14 w 52-plain and prlnted
flat :ropes and chiffons-plainand prinled Shantuugs-sleeveless.half sleeves, long sleeves-with andwithoutjackets.Every type ofSilk Dress you need for morning,
sltemoon or night.l t
Omaha and spent Sunday with
home folks.
Mr. and Mn. Oliver Fiek wereOmaha passengers Monday.
Mrs.Thelma Wicket was an
Omaha visitor Tuesday.
ger.They plan to have their an
nual picnic June 4 in the Fort
Calhoun park.
|.
emoon.Roll call was answered by
a spring verse.The election of
officers for the coming year are
as follows:pres.,Mrs.Pauline
Neale; vice-pres., Mrs. Hazel Bea.-
Hats for Women and Misses
$x.'17 and $2.77-all headsizes-all
materials-all colors-large show-ing of genuine Pnnamas, also npe~
cial group ol straw huts at only
50c each.Fashion Center.l t
FT. CALHOUNAND WCINITY
Mrs. Joe Bolln entertained eightladies nt plnochk- Friday afternoonMrs. Ira Piper won first prize and
Mrs. Hugh Vaughn, booby. A de-
licious lunch was served hy the
hostess and n very enjoyable time
was had by all.
The following ladies helped Mrs.
Mary Rosaker quilt, at a quilting
party Thursday afternoon:Mes-dnmes Joe Bolln,Henry Kruse,
Fred Moeller,Minnie Kruse and
Emma Ketchmark.
Miss Sadie Krisel and Mrs.
Stewart of Omaha, called on Dora
Klindt Friday.Mrs.Herman Kllndt,M n .Ri-chard Sievers and Lois attended apicnicattheWranchschoolonFriday.May 16, was the 83rd birthday of
Mr. Timm Ohrt, who resides with
Mr.and Mrs.Henry Kruse.A
number of friends ahd relativesdropped in to help him celebrate
and wish him many happy returns
ol the day.The following rela-
tives from Bennington were pre~
seht:Messrs. and Mesdames Geo.Fred and Timm Ohn,Gus andHugo Timm,Detlef Dessler and
Gus Bunz, and Miss Mary Smith.
An enjoyable tmie was had by all.
Mr.and Mrs.Oral Harrison
spent the week-end with relatives
near Oakland.Mr. and Mrs. T. Colhum of Lin-
coln, spent the week-end with their
son-in-law and daughter, »Mr.andMrs. Paul Kruger.
Mr. and Mrs. Fred Heise wereSunday visitors at the Jacob Sierkhome.
The following spent Sunday atthe Chris Rohwer home in Lincoln,
Henry Rnhwer,Mrs.Marie Meh-
rens and Kate, Mr. and Mrs. CarlRohwerandHenry and Mr. and
Mrs. Claus Mehrens.
A number of fdends and rela-tives helped Mr. and Mrs.EdNatter celebrate their 25th wedding
anniversary Sunday,by enjoying
a icnie in the Ft. Calhoun park.hr.. Chas. Mueller and son of
Tekamah,spent Sunday evening
clng and card tables had beenplaned for those who cared m play.
New officers elected for the com-ing year are Miss Marjorie God-sey,pres.,Eugene Burdlc,vdce;Miss Marion Triplett,sce'y,and
Miss Dngmnr Olson, treas.
The Burt county farrrrbureaulssending five club members nsthexr
guests to Lincoln June 1 to gs.
Miss Adelaide Miller of Herman. is
one of the number..
Graduating exercises for the
class of 'Bl' we held at thela de n hall Th;rsnlay evening.
Moy 14.Rev. Frank Smith of
Omaha,gave the address.His
theme was "The Formula for
Making the Most ol Life".It wasasplendidthemeandwasveryablydiscussedbythespeaker.Rev, Shhnk of tha Baptist churchgave the invocation and Rev. Nor-
lin ol the M. E. church, the bene-
dlctlon.Miss' Vera Mae Skinner
ayed the marches.Miss Elnn
etaraen w e the salntatnry.Miss Ramona Crurnbaugh renderedapiano solo;Kenneth Wachter
was vnledictorian; a girls quartet
gave a vocal number.Dr.A. J .
Cameron introduced the speaker,
and also gave the class their dxp-
lomas.Supt. Shrader then presen-ted the scholarship to KennethWachter.Several members of the
class are planning to continue
their school work.Misses Murrell
Lowe and Ramona Cgumbaughplanto attend the Wayne StateTeachers College.Kenneth Wach-
ter will dso attend and later enterthe state university with a medical
course.Wendell Mcflonnahaplans
to attend school preparatory forteachkig;Raymond Petersen andRiley Brodersen plan tn stay on thefunnforthepresent;Dprothy
Horn and Ethel Cummings may at-
tend a business college at Omahathis fall..Grandma Cooper, who recentlysuffered a severe attack of pleurlsy
ls very ill again.
Albert Hue and family spent
Sunday aftemoon at the Wm.Brandert home.Mrs. F. E. Young served refresh-
§~+f+¥Q<;£;;5'e
NOTICE OF ADMINISTRATION
Henry Mencke, Attorney[ N THE COUNTY COURT OF
WASHINGTON COUNTY,
NEBRASKA
Estate of August Dmeger, de-
¢eascd, otherwise known as Augiist
Draegert.
Notice is hereby given that on
the 22nd day ol May,1931, at the
County Judgc's office in the City
of Blair,Washington County,
Nebmskn, at 2 o'c1ock in the aft-
ernoon of :said dny, the following
matter will he heard and consid-
ered, to-wit: The petition ol LenaDrncgcr praying for the nppoinb
rncnt of imm Draeger as admin-
istrator of the estate of said
Auyrust Draoger otherwise knowr:
as August Drxwxrert, deceased.
Duted this 29th dny of Aprii,
1931.
(SEAL)1. c. Emmn,
15-it County Judge.
I
NOTICE OF AnmN|s1'nA1°|o1\
A. C. Ucbcl, AttarnnyIN 'nm COUNTY COURT OF
wAsmxc'ro N COUNTY,
NEBRASKA
Estate of Mary Klutz, Deceased
Notice is hervby given that nrthe 6th dny of June, 1931, at the
County Judxrfs office in the City
n£ Blnir, '\Vnshingwn County, Ne
'braskn, nt 10 o'clock in the tore
noon of snid day,the following
mutter wil\ be heard and consid
ered. to-wit: The petition of Johr
Klutz pmying for the appointmem
of John Klutz as ndministrabor oi
the estate of said Mary Klotz, de
ceased.
Dated this 12th day of May
1931,
(SEAL)I. C. ELLER,
17-4t County Judge.
NOTICE OF FINAL REPORT
IN THE COUNTY COURT OF
WASHXNGTON cou z,
NEBRASKA.
g Esmw of Louis Mueiler,De
<:e:u=e<l.Notice is hereby given that Hex'-
bert G. Mueller has filed with the
undersigned,County Judge of
Washington County, Nebraska, his
finul report as Adnminismmtor ot
the estate of Louis Mueller,de~
ceased,and made an application
for final administration and dis-
charge, and for the assignment of
residue of estate to such other
persons as ure by law entitled to
the same, and I have set the 4th
day of June,1931 at 10 o'c1oek
A. M., ut my office in sald County
for the hearing thereof.
Dated May Sth, 1931.(SEAL)I. C. ELLER,
17-3t County Judge.
ARLINGTON NOTES
Misses Clara Schoettger ond
Abbig Bysong were hostesses at aparty nt the former's home Wed-
nesday evening in courtesy to MissFanchun Timmerman. The eveningwas spent in playing hearts with
Miss Dorothy Cobb winner.After
this refreshments were served.The honor guest was presented alovely gilt from the guests.
Word reached here recentlv of
td George Woodruff in California.The bride was formerly a residentof Arlington and spent most of herearly life here.Mr. and Mrs. Zellen Andrews of
Los Angeles,announce the birth
of a daughter,Patricia Lqdllc,
born on May 9th,Friends herc cccived word ofNmdmnhAMin:ral:-mrwm
BELL CREEK YALLE
The Fonmnelle highwchonl he1d~its annual eighth and tenth grades\
commencement.exercises at the
Fontanelle hall Thursday evening.
Mr. Burkholder of Fremont, gave
the address and the following pro~
Home T heatre
HomeOf Pe;/'ccl razkmg Pldures
TH UR S DAY
MAY 21 `
Top Speed
With Joe E. Brown, Bernice Claire and .hck Whlllng
COMEDY-Dance Hall Marge "-
FRI DAY a nd S ATU RD AY
MAY 22 and 23
Saturday Matinee
Silver Horde
With Evelyn Brent and Louis Wolhelm
Red Riding Hood Cu¢mn-Pnthe Review No. 45
SUNDAY and MONDAY
MAY 24 and 25Sunday Matinee x
Honor Among Lovers
With Frederic March and Claudette Colbert
Accordion Joe-TALKARTOON
Why Continue the Struggln FOMEDY
FOX NEWS
TUESDAY
MAY 26Glassware Night
Cat Creeps
With Helen Twelvelrem and Raymond Hackett
Wre Wee Marla COMEDY
WEDNESDAY and THURSDAY
MAY 27 and 28
One Night at Susies
With Billie Dove md Douglas Fnlrblnh Jr.
Moonlight and Monkey Business-COMEDY
(~0MING A'l"I'RACTIONS-
May 31 and Jamal "MIl.LIE"June 7 and 8 '°SKIPPY'
June 14 and 13 "CITY S'I`REII'IS"
June 19 and 20 "RANGO" June 2l and 22 "L.\I)IIJS'MAN
Home T heatre
HomeOf Pe;/'ccl razkmg Pldures
TH UR S DAY
MAY 21 `
Top Speed
With Joe E. Brown, Bernice Claire and .hck Whlllng
COMEDY-Dance Hall Marge "-
FRI DAY a nd S ATU RD AY
MAY 22 and 23
Saturday Matinee
Silver Horde
With Evelyn Brent and Louis Wolhelm
Red Riding Hood Cu¢mn-Pnthe Review No. 45
SUNDAY and MONDAY
MAY 24 and 25Sunday Matinee x
Honor Among Lovers
With Frederic March and Claudette Colbert
Accordion Joe-TALKARTOON
Why Continue the Struggln FOMEDY
FOX NEWS
TUESDAY
MAY 26Glassware Night
Cat Creeps
With Helen Twelvelrem and Raymond Hackett
Wre Wee Marla COMEDY
WEDNESDAY and THURSDAY
MAY 27 and 28
One Night at Susies
With Billie Dove md Douglas Fnlrblnh Jr.
Moonlight and Monkey Business-COMEDY
(~0MING A'l"I'RACTIONS-
May 31 and Jamal "MIl.LIE"June 7 and 8 '°SKIPPY'
June 14 and 13 "CITY S'I`REII'IS"
June 19 and 20 "RANGO" June 2l and 22 "L.\I)IIJS'MAN
......vu....s,e...5u¢u,wnu nas|been staying at the K. J. Van Valinhome several weeks, has retumedl
to her home at Blair.The cemetery here which hasbeen owned by the cemetery ssso-
ciation ev r since it was establish-
e d, hu ently been taken over
by the erman village., £"'-. a "fi x Be" Cqo ppr af
On Wednesday the Womens Club
met. with lllra.'Jack Lazure, with
14 members and 2 visitors present.
Mrs.Ross DeMott and daughter
and Mrs.W. Snowden and eonwere the visitors.Mr . a n d Mr s. Ha r r y S eltz a tte n -
de d me f un e r al o f Mr s. J oh n La n -
d i s o f Calh oun W ed nesd ay .vu . . .
Rev Taylor of Omaha ve thebaccalaureate sermon Smgzy we
ning, to the graduates of the classof 1931.Miss Dom Klindt attended aluncheon at the home of Mrs. T. I-`.Naughtain in Omaha Tuesday,
May 19.
Miss Edna Iverson celebratedher birth nnnivernnrv Mnv m.A
Amanda Petersen spent the weekend with home folks.
Mrs. Jens Clausen helped Mrs.
G. Christiansen nf Blalr celebrate
her 84th birthday Friday after-
n o o n .
Mr.and Mrs.Ed Ehninger ofOmaha,were Wednesday evening
callers at the Harry Ervey home.
Mr:Fhanlr lhmnm nhl dnnalv
Home T heatre
HomeOf Pe;/'ccl razkmg Pldures
TH UR S DAY
MAY 21 `
Top Speed
With Joe E. Brown, Bernice Claire and .hck Whlllng
COMEDY-Dance Hall Marge "-
FRI DAY a nd S ATU RD AY
MAY 22 and 23
Saturday Matinee
Silver Horde
With Evelyn Brent and Louis Wolhelm
Red Riding Hood Cu¢mn-Pnthe Review No. 45
SUNDAY and MONDAY
MAY 24 and 25Sunday Matinee x
Honor Among Lovers
With Frederic March and Claudette Colbert
Accordion Joe-TALKARTOON
Why Continue the Struggln FOMEDY
FOX NEWS
TUESDAY
MAY 26Glassware Night
Cat Creeps
With Helen Twelvelrem and Raymond Hackett
Wre Wee Marla COMEDY
WEDNESDAY and THURSDAY
MAY 27 and 28
One Night at Susies
With Billie Dove md Douglas Fnlrblnh Jr.
Moonlight and Monkey Business-COMEDY
(~0MING A'l"I'RACTIONS-
May 31 and Jamal "MIl.LIE"June 7 and 8 '°SKIPPY'
June 14 and 13 "CITY S'I`REII'IS"
June 19 and 20 "RANGO" June 2l and 22 "L.\I)IIJS'MAN
: :<1 ~.nu mb e r ot. frie nds a n d re la dves
c ali ed on h er and rl. ver y p leas ant
time W as h ad by all.'
The
GIFT S'l`0RE
Come to the Racket Store for
your graduation gifts, birthday,
anniversary, and wedding gifts.
A big variety to choose from
at reasonable prices.
Also Summer Anklets for child-
ren and misses.
Mines and ladies $1 .00 Dresses
guaranteed fast color.
BLAIR
RACKET S'ronE
N m v sh ip me nt Pri nted F l a t
Crepe and Chiff on D resse s on sale
a t $6.75 i n sizes 14 to 4 6 a t th e
Fash ion Center.Th es e ar e reg u-
la r $ 1 0 values i n s ma r t n e w Si lk
Dresses Bo supply y our needs from
th is g r ou p th i s we ek .I t
For Road Service Phone 164
S T O P '
0
a t t h e
Marathon Service Station
3rd 1T$"w.».ag§S"§1l .
NOW 1
Open An Nigm
C. Coope home.
Plans --~ poppy day, Saturday,
May 30,'were made at n meeting
ol the Auxiliary Inst Tuesday,Little girls will sell the flowers on
the street.Mrs. Ben West is thechairman.Mrs. Otto Kjeldguard and son of
Blair, visited Friday nt the Wm.
Brandon. home.
Andrew Jones of the old Soldiershom¢ at Burkett, Neb. is visiting
here nt the home ol his grand-dnughter, Mrs. Earl French.At the last meeting of the Bap-
tist Mission Circle the unnunl elec»
tion of officers took place Mrs.
A.L.Sullivan was chosen presi-
dent.Miss Ncllye Custer,vice:
ter , Mr s. Milo Sc ho c k s of F re mo nt
visi ted Mrs . J . W . J a c o bs in Blair
Fri day af ter noo n.
Mr .an d Mr s .Osc ar He n d va ll
dinnerguests at the Dan Phillips
home.
Mr. and Mrs. J. L. Petersen andRobertwerebusinessvisitorsinFremont Monday.Mrs.Milo Schocks of Fremont,
Mrs. Ll L. Parkening of Omalln,
spent the week-end with her par-ents, George Hineline and wife.Clifford Hineline and family
and Frank and Bill I[incline were
Sunday dinner guests of Chas. A
Hineline and family, west of Blair.
Sunday n picnic was held in theCalhoun park for Mr. and Mrs. EdNnter, this being their silver wed
ding- year.There were around 75
present.Those atiending from
here were Harry Seltz and wife.
Roy Anderson and wife, Will Sullyerland,Frank Keegan,CllarlleHineline, wife and son,Virgil, Joe
Fully and family and Jnck Lnzure,
wife and daughter.
l John Hinoline and wife had as
fSundny dinner visitors, John Kla-
- " ._ - . - ..w. .¢ - . - u ¢ .- - v - v . .Klotsc he,27,fo rmer p n n e i p d o f
Ar li ng to n schools six y ears asw-
She had been in Boulder, Colo. the
pas t f ive y ea rs for h er he alth.
Th e Ar lin g to n ba ll te a m wo n
fr om Nic k er so n Su n da y , 9 to 1 i n
a ga me a t Nic kerson.Th e Bla ir
J uni ors wo n f r o m Ar li ng to n J u -
ni o rs 5 to 4 a t A r lin g ton p ar k ..
V .V .Ma rs ha ll and J oe A n t r i m
returned Sunday fr o m P i ke s Pe a k
whe re ma y sec ured a tr uc k lo ad
of trees : from the frovernment l
Mr .an d Mr s .W .li .Hilleg ass
a n d son were week -end gh o sts a t
thf- Fre d.De W eb er h ome.
Str an ge rs wh o pa ss thr ou gh tho
villa ge o f Ar li ng to n wi ll n o w b e
awa r e o f the fac t.Th r o u g h th e
efforts o f the Co mmu n ity C lu b a
u n i f o r m sy stern o f ma rk er s ha ve
be en p lac ed at a ll of th e ma i n in -
tersec tions o f the hi gh way s sur-
roundi ng the c ity .A welc ome si gn
ha s been plac ed a t the east a n d
we s t entrances,an d twenty '-five
sma ll signs have been plac ed on
th e fenc es alo n g th e ro a d s Th e
follo\\ll.| ;r are the c itizens sponsor-
in g the larger signs:Rcc krney er
I l d w e Co.,Mar sha lls Nurseries,
Dr s.Davie s a nd Bloc h, D rs. Cady
an d Nels on,Fr ed De W eber , Don
W ebe r, P . z the S hoc ma n, Ar ling-
ton State Ba nk and J . A . Peterson.
The Amer ic a n Leg ion , W as hi ngton
Co . F ai r A s s' n . an d th e C ommun -
ity C lub a ls o llll\ ¢ s i gn s .
Dr. Hugh V. W hite, sec . of Con-
gre ga ti on al Bo ar d of F ore ig n Mi s-
sio ns, of B oston, ga ve an ad dre ss
at a Fe llowshi p s uppe r a t th e C on-
gregation al c hurc h Friday evening.
Th e a f fa i r wa s i n h on o r o f th e 2 0
n e w me mb er s rec ently received
gr ai n was gi ve n : pi a no s o lo , Mar -
garet. Iamghorst; voc alsolo, Sophia
W aterman ; e or net s olo , Alvin W i l-
ltening; song, 10th grade.Th e 10 th
gra de graduates were Gertrude
Sc hafersman,He le n W ilke nin g,
Mild red W i lson , V ern on B roc kette,
Robert Cahoon.Th e ei gh th gr ad e
gra du ates we re Glad y s W ei tk amp,
He le n Fr a n k e , V i o la Ho ltma n a n d
Rollin Ch ris t.
Mr . a n d Mr s . W m.S th u ltz a n d
f a mi ly were Sunday guests a t
A u g u s t K e r k h o f f s .
Mi s s Es th er Dic kmey er,oldest
da u g h te r o f Mr .and Mr s .He n r y
Dic kme y er, was un ited in mar riage
to Osc ar Scheer,son o f Mr .an d
Mr s .Fr e d Scheer,Sunday af te r-
noon a t the St.Pau ls Lu th e ra n
church.The y o ung c o up le uii ll go
to ho u s ek e e p in g o n a fa r m no r th
of A r lin g to n .
Leo na Ho ltr na n an d W esley
Meierhenry spent the week-end
with llolI|| 3 folks.
_ Fremont callers f r o m here this
week " e r e Mr s W m.W ilken ing
and He le n,Mr s . W i n .Ho ltma n ,
Mr . an d Mr s. A ug us t Ke rk ho ff a nd
Stanley ,Mr s.Mi nn ie Lallr nan,
Mi s s Min nie Lallr nan,Clarenc e
W ilk eni ne.Alb er t L a llma n an d
I r vi n llo ltma n .
The Lallraan school c losed Friday
fo r th ei r s u mme r va c a ti on af ter a
very suc c essful term of sc hool.
J o h n Ec h te nk amp,Sr.o f A r -
lin gto n,c alled a t W m .Ho ltma n ' s
Thurs day .
I r a Ross returned to his .home
at S he lton , af te r a s ds ti ng A ug u s t
ifnrlrhnfi urUlu h h f auna nrnvlr *Hn
I |Ir .C r e p e a n d C h i f f o n D r e s s e s o n s a l e
e a t $ € § . 7 5 i n s i z e s 1 4 t o 4 6 a t t h e
Dre~es Bo su~ply your needs fromthis group this week.I t
Out of
the Sky "
Can Come
Disaster
HAI L ! !
Might ruin your crop
STDP!
a t t h e
Marat12|§§§Xi§§§tation
3rd and Washington Streets
dinnerguests at the Dan Phillips
homef
:I I
Robert were business visitors inFremont Monday.Mrs.Milo Schocks of Fremont,
1
a t t h e
Marathon Service Station
3rd 'li wa.aiagaf§"§;-eat.
Op en Al l Ni gh t
For Road Service Phone 164
W h y G a m b l e W i t h
Your Income?
into the c.hurc.h.Mr. and Mrs. C. C. Cook werehosts at nn evening party lar the
members of the Merry Go R°\§`nd
Club Saturday.Pxizes for hlgh
scores at brldge were awarded Mr.
and Mrs.Vemon Marshall,andfor lo w m Mn. W. H. Hillegua
and Dr. D. M. Bloch.
The Baccalaureate suvioe was
put several months.Mlss Clan Schweder spent last
Thursday evening at Wm Wilken-lng'a.
504: Silk Stockings for Women-new low prllre 891:or a 'smlr 81every day in the yen--al sizesand _Solen thi§_ is the nandard
Pay when you sell your crop.
Corn rate -----2.5%
W heat rate ----.3%
»
Hanson if Mehrensheh! on Sunday eveninigt the M.
E. church. the address ng given
by Dr. Raymond C. Swisher of the
|Congregational church. The churchIwas ureltilv dofnmind fnr the oc-
ouc nomery som by all nares av50c u padr--but the Fashion Cen-
tercgrice is now 89c nr 8 pair SI.
ildren's Shoes-Slippers-Or
[ords an_§ti1l §.1 gt the 1?»=hIQ"InsuranceReal EstateI n ve s t m e n t s" " "m-,; 5[,;,"""'n Gomer.mo n a u lue l-'nl ue l wand the clul colon.All applvprl- $850.1|
°*g,§§j=S;_';;;°§45f ¢ of ml S-=»;¢»+b»f°f1r»=E»»»»~»~
.aemiax
Blair, Neimn, Ma 21 1m
_ » - -
RK
EBRASKANA
'I "s,1, .
I *
.9 5
Advertise in
Wahxess wan
Cale.Experience
The Sewing
Lutheran church
day afternoon a
Louie Hunk.
Mr, and Mrs.
daughters were
ning visitor: at
home, west of .
The Ente .
poets Tuesday
it the home of
Deusen on west
Mr. and M n
and son, Billy -
Monday visitors
Wm. Kdu' hom
The Enlerpris
an announcem~Lorraine Jenee,
Stewart have o
15, 19:31.
{".nnn| 1! s:..~nintruderlt Lender E.!c e:nses- . . -- f ' ~
WHITE AN I
m a r
_ _ .._ .--.
Funeral services were held at
~e M. E. church at Arlington on
ednesdny afternoon for Cdvln
~. Marshall, 85 yeanof age. The
- ==~ was born in Ohio where
.spent hls youthful da y ;In
B82 he came to Arlington vi-
lah-'.nY'\g hh h0.na l i l ! l l l
amlly on the farm naw owned by
--Scheer.In 1893 he len,
~ving ta Lincoln when he re-
- ~ed for aeveral yearsbefore mav-
~z ba Kansas.From there he
~nved to Oklahoma, xedding them
dl his death.The funeral services were in
¢ ge of Rav. Knott of the Sevien
ay Advent church of Oklahoma
~ty, Okla.Burial wu ma de in
e family lot :n the Morley cem-
ry-.Seven children survive,all of
~om were present except Mrs.
~yrtle Crandall ol Cove, Ark. Thu
thers are Wllllam J. Marshall of
~rllngwn,Ollle W. Marshall of
ennnrd, Mrs. Ida Sutton of Oo-
~gton, Okla., Mrs.Lydia.Sutton
I Hennesee,Okla.;Mrs.Corn
risrnan of Wichita,Kane.and
~.Della Crandall of Rushvllle,
~o.Besides these, grandchildren
~ » 13 great grandchildren survive,
e deceased was a cousin of G. A.
~ax-shall and A. C. Marshall of Ar-
l
I
I q 1
.f Ai ._,gn
3:~~
in
6
.
f ~.
.*'_fr.'>.:
?~» f ~ f < <
i u ._.11
& : »r | , `'°'};PI,? ? ' * ` f ;= s ? ; ~ § > # H % = @ ; ¢
.i l', f § 1 F 1 :~~
'f x *~i "; _p ` §° "
.¢ "" ` » \# I \; , 3 ' E '¢ , T @ » , » Jg f ,& _..- | | L.~. ~-
c. nam.~
tlllndtllalldnlhm .I |He ll shown, HIM....\.m n » n » -. n . u » n » u u ruthlllnuivnlilyolllahnlh.' |» .
- . . -- f ' ~
WHITE AN I
m a r
_ _ .._ .--.
Funeral services were held at
~e M. E. church at Arlington on
ednesdny afternoon for Cdvln
~. Marshall, 85 yeanof age. The
- ==~ was born in Ohio where
.spent hls youthful da y ;In
B82 he came to Arlington vi-
lah-'.nY'\g hh h0.na l i l ! l l l
amlly on the farm naw owned by
--Scheer.In 1893 he len,
~ving ta Lincoln when he re-
- ~ed for aeveral yearsbefore mav-
~z ba Kansas.From there he
~nved to Oklahoma, xedding them
dl his death.The funeral services were in
¢ ge of Rav. Knott of the Sevien
ay Advent church of Oklahoma
~ty, Okla.Burial wu ma de in
e family lot :n the Morley cem-
ry-.Seven children survive,all of
~om were present except Mrs.
~yrtle Crandall ol Cove, Ark. Thu
thers are Wllllam J. Marshall of
~rllngwn,Ollle W. Marshall of
ennnrd, Mrs. Ida Sutton of Oo-
~gton, Okla., Mrs.Lydia.Sutton
I Hennesee,Okla.;Mrs.Corn
risrnan of Wichita,Kane.and
~.Della Crandall of Rushvllle,
~o.Besides these, grandchildren
~ » 13 great grandchildren survive,
e deceased was a cousin of G. A.
~ax-shall and A. C. Marshall of Ar-
g '~f
lr
.Q
*ii
¥.
<
r J
2 .in
6 \
¢\
1f e
1 5,1 .|" 3
1 ":t " "
* f H . f ;" ;" f "f l i ,
.e:P i j 5 ¢..~, - Z n '_4 ~ I , , L ¢ " ; < T
J ," } \l~n Q - i ` , 2 '= # ; . = s
~e r ;1 :e 7 1 3 4 M.= : .»; »
L Z ~ ' f : %, ; ; g % " 2 f : . :
~a s J . - . 1 _p w J /" 1 § " r p : { l \ \ 5 » ' 7 °. . ~ f 3 , . .
# E R I , 1 " j _ . f .
; f . : = :~ 1 ;~ ~
\..»& f ~ ¢i t ; ¢ . ; . » 1 , _ 3 , : ¢ ,' f ; @ f 4 = l a
. g f .r "~I .
C.L .Cla r k ,neoln a t ~
hu recently comp ated his I
tion of the Nebruknm pm:~
He is shown,right, lundi~
book In Dr. H. Adeibert Wh!
th e Un i ve r s i ty o f Ne b r u k l.
.r
' |» .
CLA
PPS"*'1s=
Ballard i { I I ' T» ¢ n € " ¢ i £W m. w e n l l e e n l d hy l h a d l y mn n m
rl e | 1 d e n c u pw p u' t y m» u n¢ h t ln h kr y e l n | .h a nl ¢ o l1 l qu o r
\v v u-q
|5 a n i me , I ma g - n ~ h _ ¢ l = q . d ¢ r v 9 ~._ , _ __ 1Lili'Lock the DoorIlaw md rumor hu it that he willi 1n~ me apnng or 15881 stocksooix www mme.company was (armed in Blair with
,m Emma Wright and dnugh- Jake Wnumbold as president;'°" ter,Lila ol Omaha,spent the\'l'heodore Hxller, vice-president and
It week-end at the W. V. Wright W.A.Bennett,seaetary andrut home.On Sunday, Mr. and Mrs. treasurer.The capital stock ofi-he
es- Tom Wright m d children at company was $25,000.This was
lanima, Neb., were duo present the tint horse collar eompmy in
4..- ,u.».».»Blair.The bdldinz which the
'he Enkrprise.
led at Robim
not necessary.
ircle of the Fi
met last Wedn
the home ofM
.=;"...':ngi n ?m'¥> §
. j,Lf:J§'»'s=.:'»e.,= F
George Kuhr nnd
Mt Saturday eve-
the Harry Larsen
enmard.
AStu' kemington
diernoon, May 26
Mrs. D.c.Van
W.--Mxs. C. L. Patterson ol Denver,
Colorado, who has been vldting at
the home of he r dmghw,M n .
Burl Vaughn, went to Minneapolis
w vidt anodmr dnughter last Sat#
urday and will atop Bzlin in Blair
on har return trip.
plnnt occupied was on the west
dde of Walker Avenue, just north
of the rdlmad tracks.The enm-
pmy did A thridng business and
at one time employed around one
hundred and twenty-five men.
hater mit wu brought against
the eommny for infrimzement on
Gra nt nre et.
Ken ne th George
Omaha, were Inst
a t the parental,
\ on est street.
e is receipt of
t of e birth of
la..vu...
M u s V e n u a mn c w l e a u auc-
ceaxfud schnol year as teacher, at
Syhiker last Wednaay when they
wnund up the yur'a wo rk by
lmlding n aehool picnic on that
dnte.Her mother,Mrs.Chas.
Lunb,of this city,attended the
pimlc.
pa te n t r i g h ts a n d wh e n th e h u i i d - |
i n g a n d p la n t b u r n e d i n th e ea rl y
ni ne ti es th e pu bli c su sp ld o ne d th e
Er e was ol an in c e n da r y n atu re .
L a t/ e r mo th e r c omp any wa n in-1
eorporated wi t h C h s .Ro ss a s
president wh i c h p la n t i s s ti ll i n
oneralinn.YIYHE mmlllar adams nbont lock-Haas not had a chance u lt.TM.:illlu E F "Mr .an d Mr s .M. D . N e we ll a t-In 1 90 1 Blai r ha d tak en o x; met-I .ing the stable iio or af te r the
a,o n a5' teflffed a f a mi ly g a th e r i n g a t th e ro p oli ta n ideas an d th e c itizens horse has been stolen applies above
Av\|n|:r|'nl|rmrlr I n i t Rn n da v in \._:_.| .._ ..-____all other foods 10 cuties. W h;2 you
ls simple.All y o u h ave Lo do In
to buy one of tho kind) ol cole:that come Ln vacuum packed msn,
nnd then continue ln keep Old
Man Oxy gen away ,utte r y ou h nve
onened th a can.by n n l u n :th o
nderson and baby
lass., am expected
i . " " ' a '" 1 . 1 i 1 » . ' . 1 a ; z . a i " ' ° u m v n v l ~ - " 1 " g v v e m -ur, un.. Pqle y mug : d Qm : ;| ¢ \hp:| t c °o Hi ne .D- » , gm" = ;-5;-!ivant In c otlce is flavor and aroina.
Thes e ar e ne ver stolen, but onc e
nm Man Oxvzen c omes in c ontac t
Mrs.
of Carr]A. E. ALbridge, ne
:".' f l ~ " ~?¥"r.*" Za -'"f,3»Z '",f,1 -~, <, ' ° ' , 1 ' £ \ | ' f - f ' r ~,»1 t = : . v ' .1 ~
.~ :L * I { J ~f * j f g !
~"a v g 7 `;< f ~: =. ~
a » = ~ £= a »' e » ¢ f § § : f f ' ¢ >. :
a ._j "::|
l"|'\nln l\\||\r\|-\Yllwnu0
ne y , 'mon l.h | be f or e th e e di to n c an f in -
P°°'i l k t h e t n k o i p n p u i n g b i o g r a -
q g :p h i e l f o r N e b r l s k f l le l d e n , "
to r each uimr s unda y, may z e, vol
spend the summer at the parental,-
H. J . Ha n se n h o me .
Mr s .Els ie . Ay e,wh o fr ac tu re d
he r li mb r e c e n tly , wa s a b le to r e -
tu r n h o me la s t S atu r d a y f r o m th e
Emma nu e l h o s p ita l i n Oma h a , a n d
is g e tti n g alon g n ic e ly .
hi r .an d Mr s :W i ll Co o k a n d
da ug hter ,Ma r g a r e t o l Oma ha ,
we re Su nd ay a fter no o n vi si to rs a t
the home of hi s siste rs, Mrs . Annie
Ma r t i n a n d Ma r y J . C o o k .
fie ld, K entuc k y .Ar o un d on e hu n -
dred relatives gath ered f o r th e
pic nic dinner..
Mr .an d Mr s .Ma r t i n Bertelsen
en te n ai ne d th e pinoc hle c lub ah
their h o me la s t Mo n d a y even ing.
Mr s .Chas.N .Ha n s e n an d J uli u s
Pe te rs e n wo n th e h ig h pr i z e s a n d
Mrs . A. R. B roc k an d J en s Nie ls en
lo w.A f t e r u. must enjoy ab le e ve-
n i n g Mr s .Bertelsen ser ved a ni c e
lunc h.
Mr. a nd Mrs . Be n P ec k an d fa m-I
district at that time and throughi
his intercessiohs n hill was passed
giving Blair lthe fine building
which is not equalled hy any town
in th e sta te o f her s ize.
Blai r ha d, u p to 1 91 2, d ep en de d
on the oid Germania. hall, a wooden
str uc ture loc ated o n east W ash-
in gwn stre et, f or a p ub lic a ud itor -
iu m f o r a ll g - a th e n n g s b u t a f i r e
destroy ed the buildin g an d the c ity
wa s lef t with n o su i ta ble p la c e fo r
pub li c ga the ri ng s,
wi th c o lf c o th ey be lla to e sc ap eve ry I ns t.F r o m 65 % to 7 0 % o f
the c ause gas and an apprec lable
part of the aromatic oils disappear
in his c ompany in the llrst lwentY'
four hours, and b y the end of tenor twelve day s of exposure to him
the cones has lost all of its aromaa n d navor,a n d has bec ome n o
tic eably stale.
So the th ing to do wh en y on 're
buy ing c oifeo ls to make sure that
th e stable o r has been keDt
loc ked, an at Old Man Oxy ge n
col!ee in o. screw~tu\1 rubber gan-
k et mason ja r. an d k c c n ln s th otop sc re wed on I t tlght.
It Can 't Get Stals
Fresh roasted c odec Bac k ed ln
a c ontainer whi c h is ab o ola te li
imper vious to all c li matic i n la -
enoes c :| n't get stale, This method
ol pac kin g ls k nown a s the "va o~
u u m proc ess"an d th is k l n d . o t
conee is k n o wn as *va c u u m
pac ked"co\!ce.Lo ok fo r t h a ntwo i mp o rta nt wo rd s o n th e n ext
can ol cones y ou hn¥.°
»
H n l l i l i l f HIM . lllllill t he
l m l r h n u - . n . u ¢ \ u n \ | H n , ° 1
u a v - l m - n v ll im m a .Both
me n nre me mbe n nfi he b o nr do t
govemors of the Nebraskana so-
dety.
The prospectus was prepared by
the Baldwin company of Hebron,
with whom the society has a con~
tract for preparation of the new
biographical history.Mr.Clark
asserted that hc was highly pleas-
ed with the material included i n
thg prospectus, as well aswvith the
full page photographs and general
make-up of the advance copy.
"Of course it will be several
N e w sh ip me nt Pr in te d F l a t
Crepg and Chi ffon Dr esses o n Bale
at $6. 75 in siz es 14 to 46 a t th e
....;\
And Bow!
Who is this famous woman so
many people talk about today-I
this Anne Howe?
I Not Six
Out on the farm where men are men,
The women»wives, aunts or nieces
::a :|
CONGREGATI O NAL c mmc a
A.F.Newell.Puto r
'rms a tmjch will join next Sun-
day morning in the union Mem-
ohal service `Church séh5f»1 at 10 o'clock as
lar 0 values in smart new Silk
Dresses so suppiy your needs from
this group this week.l t
kept in hand
By cunning big pies in tour pieces.
are being mailed to persons selec-
ted to appear in the history as
fast as the eligibility committee
passes upon them.Each person so
honored is made n life member of
the Nebraskana society.We be-
lieve our association is doing a
worthy work and the splendid oo-
opemtion we are receiving in
Washington county is appreciated."
It is urged that persons who re-
ceive questionnaires mail the in-
formation in immediately so that
Blair and Washington county will
be fully represented.
\c h ur c h with Rev. Ha ns Ne ls o n a nd (Fu ne ra l aervic es we re he ld o n
Rev. Lu nd o ffi c i atin g.Buri al was| W ed ned' day a t th e Ho f f mxm mo r -
mad e i n the Bla ir c emete ry .tuar y c h apel at 8:30 a. m., and St.
..:|:~
the school board immediately re#
hired the 850 married women now
emplcyed.
aéuhers i~the ~ublic sch~ls of
Cle ve lan d, Ohio with s in gle women
was withdr awn in th e f ac e of pr ac -
0 : :l l l ::|
Cecelia church at 9 a. rn.with
burial in Holy Sepulcher cemetery.
At one time Mr. Craven oper-
ated n. livay stable in Kennard
dbefore he went to Omaha to red e.
to n,Oh io on s even ac res east o f
to wn k n o wn a s B lo e d o r n f a r m.
P e n d e r - W i l li a m A lb u s h a s p u r -
chased 80-acre f a r m f r o m E r n e s t
Stuc hen smidt,loc a ted ab out eight,
mi les so u th wes t o f to wn .
.:|1 |4
NEBRASKA WEEKLYINDUSTRIAL REVIEW \
Wisner-Tourist camp to be
...._
MARRIED TEACHERSm=:-1NsTA'rEo
We wish to express our srrati Mr. and Mrs Skov Nielsen and
grandson, Paul Smith and Mnand
Mrs. I-I. J. Hansen spent last Sun-
day afternoon visiting at the Nels
Nielson home, near Kennnrd.
Frank DeTcmple of Los Angeles,
Calif.,is expected to arrive the
iust of the week to visit his mo-
ther, Mrs. Geo. DeTemple of this
city.
Mrs.EmestTornblad retumed
ily of Tekamah, Mr. and Mrs. Geo.|The firemen had long cherished
Peck ol Omaha, Mrs, Blauah Wax-
rlck and daugl-|2er,.Gail, of north
of Blair, visited last Sunday with
their father,Mr.Sheldon Peck,
who irconfined at home and also
with their sister,Mrs.Bertha
Gollohon_
New shipment Printed Flat
Crepe and Chiffon Dresses on sale:hall was built.It is a substantial
at $6.75 in sizes 14 to46 nl. the '''r.'...\.:.... r-....»...ma--...-- _.....I
I
|
the idea ol having a home and a
public auditorium where they could
hold their meetings and had somn
time before purchased low for that \
purpose just south of the post
office.In all they had a fund of
severai thousand dollars and joint-
ly with the city, the present city
building of bnck and matches up'
tude to our friends and neighbors
for their many acts of kindnessdurihgtherecentillnessofour
dear brother and uncle,Allen
Phillips.'We desire to espceinlly
thank those who furnished the
music and the minismr who spoke
words of comfort and sympathy
and also those kind friends who
sent such benutifd floral offer-
11188 home last Sundny from the Em~
manual hospital in Omaha, where
she had an operation for goitrc.
She is improving slowly.
Mr. and Mrs. Ernest Frofk and
baby of Auburn, Neb., drove in last
Thursday and enjoyed a visit at
f u n w n w n w . .u m b e u w ' q u -la r $ 1 0 va lu e s i n s ma r t n e w Si lk
Dr es sa so s u pp ly y o ur ne ed ; f ro m
th is g r ou p th i s we ek .l t
ms'ronY OF BLAIR
(C on tin ue d f r om p a ge f o ur )
n i c e ly wltn me p o n o n ln e , ma n n !
n ve ry p re tty ap pe ar an c e o f wh ic h
th e f i r e me n a n d Yhe c ity are e x-
tr emely pr ou d.
A m o n g othe r in stitutio ns o f
me ri t in B la ir i s he r li br ar y .Ta k -
inv n rlvnmmmw nf u...llh o r a l i tv n f l
Eva, PhillipsMr. and Kim Elmer Pate
Ida and Ruth
w. w. DIXON
ceptionally fine grade of ice, much
better than the common raw
water ice.
The output of the plant is taken
by the ice users and the farmers
ol the same,trees were immedi-
awly set out and later an iron
fence was put around it.
Another prominent feature found
on the record books of the city
during these dun of the eighties
was the granting ci'saloon li-
the fiscal year ending May, 1925
the total output oi ice was 1,-
946,800 pounds, which brought in u
gross receipt of $10,024. The plant
has been a paying investment for
we city and the five yean um ithas been in operation has netted
the city s profit of 89600..
Thr; review of the water system
and the 'iight and ice plants hah
lend us up W present day hap-
Pwnsu.but there are earlier
events worth mentioning that go
along with the development of the
city.One of theie is the gaining
possession of the Castetter park.
This park is locai/ed on Fourthapd
Butler streets and is the largest
park in the city.
On August 16, 1887 A. Castetter
deeded this park in the city on the
condition that the city pay $100
per year for five years on its lm-
LOCATED EAST OF CITY LIGHT PLANT
K. W.
Pig Meal
23 0 Protein
for
$2.25 per Hundred
Contains
Murphy's Mineral
Made By
T h e
Blair Feed Mill
;..,.1:. and WRIGHT, Pbops.
O"UPJz
rnEE3
»<:
zEno
Andrew Carnegie, the citizens of
Blair made application for a build-
ing which,after the usual preii-
minaries, was granted and in De-
cember, 1916 the cornerstong was
laid and the work went steadily
Food Vinmlu
Government lens show that dm-
mln G,n food factor promoting31-ovrih. \| from me m eight tlmu
more nhnndnnt ln beef liver, pork
liver md had kidney than ln lean
beef,pork or lhmb,
building stood forth a monument
of beauty and a mark ol the infer
est which the city took in the edu-
cation of its citizens.
Its location is on Lincoln and
Fifth streets just one block west
of the city hall.It has proven a
great boon to the public.Its
shelves are stored with f.hou»
sands of books ol different types.
Books ol historical value, fiction,
poetry,or romance xnsy he had
for the asking besides hundreds of
vollunes of magazines so that no
one may go hungry for the pre-
sent day happenings.That the
public is taking advantage of the
library privileges is evidenced by
the fast that during the past year
the average daily circulation of
the books was fifty-eight and the
total cinulation for the year was
14,575.
W. W. Dixon was born in Jasper
County, Iowa June 5, 1861.when
he was [our years old his parents
moved to Nebrlskn and home-
the A. R. Brock home, returning
to their home Saturday morning.
Caleb laftis ia getting along
nicely from a recent operation at
an Omaha hospital.I t will be
necessary for hlm to submit to a*seeond operation before he com-l
pletely recovers,`
Market .prices from the various
produce houses of the city for
Wednesday an as follows, Eggs,
1Ze; Cream, 1'lc; Spring chickens,
Leghorns,20c;Heavies, 23c; and
Hens, 18c; Roosters, 8e.
Peter M. Tyson returned homel
last Saturday from Apple Rivex-,'
Illinois where he visited his
cousuin,Marshall Tyson,who is
qulile seriously ill with cancer.H
also visited other relative
Elsie Hughes of this city,at-I
landed the Alumnae reception held
last Friday evening at: Menlo, Ia.'
She had the honor of traveling thc
farthest distance of any in atten~
dance at the Alumnae that evening.
:tended five miles north of Bldr.
In this community he grew m
and in early life beganE.°."f.. Blur,
In 1881, Mr. Dixon was unitedin manringe with Miss Elizabeth
Wan-ick of Blair.To this union
five children were bam: Mrs. Vesta
Carmichael,Lincoln;Mn.Merle
Bovee, Rosalie;Mrs. Cleo Conley,
Des Moines, Iowa; Mrs. Ruth Wil<
liamson, Nieoma Purk, Okla., and
Wesley,Jr.,who departed this
Efe in Nov.1916 at the age of
fifteen.'
In the year 1889, Mr. Dixon and
his brother, S. S. Dixon farmed a
parternership and began barber-ing
in Blair.Later Mr. Dixon went
into the business 01' painting and
paper hanging.In 1915, he moved
to Bethany in order 00 give his
children a better opportunity to
attend Cotner College.Here ho
continued his trade until a few
weeks of the end.
In 1890,Mr.and Mrs.Dixon
unlmd wnh un nhrzeeim. .-\m-h.
| - I - 1 : -n n : - 1
ONE CENT
SALE
Smashing all records
for LOW PRICES
MAJon. smmMr. and Mrs. Glen'McDonald and
III
usual.
The young people meet at 6:80
p.m. for their lunch and discus-l a m " M e i n ,
GH" num Jonu E"¢"'°"'=h|mn umidr man.aing Conltrudlon °°'of °""""- '°' Mn. JJ.,wumyuu fmalyuit
i ";.'L"'1,.`2=°l'.. PMI .'lu....?'....»..e2§"=.2!,'?!f'r¢ '::¥°£§'f°=~nz1'f VAR NI SH
Séon after this Mr. Dixon became
an elder in which capacity he
served until moving fn Bethany.
He was a man of a cheerful dis-
podtion, and n generous nature:
he was n good nelghbor, a kind
husband, a loving Luther und an
active Christian worgr.
.Aprll 9, 1981 Mr.ixon received
1 paralytic stroke from the effect
ol which he never recovered.The
end came at his home in Bethany,May 10.The funeral services were
conducted at the Bethany church
Thursday morning,Rev.Hugh
Tomox, the nuwr. officiating. Thd
bo dy wu then brought to Blah'
for interment.A short service
...yn ...........,.I
New shipment Printed Flat
Crepe and Chiffon Dresses on me
nt $6.75 in dzes ll. to 46 nt theFashion Center.These are resu-lnx $10 values ln smart new SllkDresses so supply your needs from
this group this week.I t
TEN ACRE CORN
YIELD CONTEST
Lan week two additional farm-
Wuhingwn
yield contest,
Agent Bates
other raisers
this nonulll'
era enrolled in the
county wn acre corn
amording to County
of mm-.
I! there are any
danirnnn nf lnlnlnu
uv nas.1 I-run 1 lo w v v | 1 H u \r v~\°.1 r " "
AF E W AY T~m-3
Sllewly ld for Fd & Sat., May 22, Z3 in Blair [ .
0 I
S u g a r P m e a p p l e [11
"""Z~§."'2.`$'2§¥.'}u g m,...m¢ Brand ~l"]
§° ; ~ ,§ ~ = " M i '"°"°'.§;,:'::,":'§.':."' '""[1]
B a s - 4 7 °E a c h ,1 9 C [l ]
I Strawberries £?.f5%."l2 ---l°¢
~\gggg;-Rf»=_ _ _ s ¢[
I - _ I - |[..]0 _P i c k l e s g o f f e e E 1
[..] Sf°'.§~...»'2'?'..,,°Z....
'" : f . ,, ' ° ~ "~|
I [~]
~~[, ]
_;i ! § ' ~ i | ~ L . . L , ~ i ; . _ - ` i -~;___
»--;_5 .._L__]
fa Cantaloupes 35.5° su.25c
last Sunday at the home of Mn.
Rachael McDonald,. who resides
south of Blair.
The Royal Neighbors held their
regular meeting at the Modem
Woodman Hall'last Wednesday
evening.Plans were made for the
her e.
Creighton-»~»Largen Ma nu fa c tur -
i n g Co.ins ta lled e ie c tri c ar c we l-
der.
Daykin-Hain street graded.|:| |\ . a |.|~
poured lor n~w building of Wea-
tem Public ~Mae Co.,south of
U. P. rlgh ~-way.
Lincoln-G ~as farm income for
year ending ~e 30, 1930, totaied$468,158,000 ' or nearly 12 times
farm income of 50 years ago.
Scribner-Laying oi pipe lines
completed and natural gas system
now available to consumers.
Hyannis-476 bales of musk:-at
skins shipped this season from
here, valped at $70,000.
~entio~ ~hi~ wil~ ~ h~d in ~;
dty Monday, June 1.
Mrs. A. F. Newell entertained at
dinner Inst Wednesday evening in
honor oi four o! the young ladies
of her Sunday School class who
are graduating from the Blair
high school this week.They are
Misses Frances 0'linnlon, Frances
Sien,Jean H. Stewart and Dnt~
othea Gilbertson.
z FOR THE |
of
1 mu.. reg s4.so
2nd su..
z au..$4.51
l QT. reg. $1.25
Ind QT..01
1 qrs.$1.26
was held at the cemebery and the
body was laid to rest.-_Contributed
CARD OF THANKS
We wish to take this opportunity
of expressing our appreciation for
the beautiful flowers and kind
words ol sympathy in our recent
bereavement;we dsc wish to
thank the singers for the hymn so
beautifully rendered and the min-
ister for his words of cousoLaEon.I
content,they are urged to get their
application blanks just as soon as
possible.Blanks will be mulled,
sent or given personally upon re~
quest.
l r mn or more farmers com-
plete the contest, medals will lx
awarded the winners.Also, those
produdng one hundred bushels om
more per we get medals and an
uutomaticllly taken lata the sod
ety of "The Hundred Buahel Club"
Two Washimrttm county lannen
T H E manufacturers of Ma j o r
Spar are sponsoring this 1 cent
Sale to further advertise the
remarkable qualities of this fam-
ous varnish.l t is A general
purpose finish,for all Interior
and Ext eri or surfaces,giving a
~l|
W ear - proof,W eather - proof |
lW ater-proof andMar-proof coa
ing to Floors,W oodw ork,Furn
Mrs. W. W. Dixcm |.f._..' ..1..,....a... ..`f.........\.....r' +\.¢. RN-IMrs. v¢s¢£<;§¢i§1m¢1 3, "£L`L§`Z1°§.`"§`° 'va 2? Blair,
1f'¥'*' l[erleBoyee who ofiicially produced 106 bushelsMrs. Uleo ConleyMrs. Ruth Williamson
iture,Linoleum, Porches,Boats
Autos, etc.No finer varnish.....|-.-_,........,...,,....,~.N. .born in Kxlsdana, Norway, March'
80, 1858.In 1868 Mr. Eager em'
mlgmwd to Ame da, c oming on
West Point.A few years later he
humeabeaded near Howells, Colfax
County.He settled at Blair about
1900.
ln1 B7 4 he wl n\mi te di n mm-»
no enwr some new now couwmmnot less than 10 aces, and it ml:oonhin my additional number o
sues."
WILL CKAVEN DIES
AT HOME IN OMAHA
wma una ran;-ivnfl Sundnv an
UPON HONORI s|
P A I N T1 -- - 1 - .
Upon Honor Paint with the great-rlage to Christina Johnaan.To
this unlon wen born :lx children,
three ol which died in infancy.
Mr. Enger passed away, after s
paralytic stroke, May 18, 1981.He
is mrvlved by his wife, three dull-
dren,Fred Hager of Herman;
Mrs.Anna Marie Sorensen o iBlair, and Jurgen Enger, when-
abnuts unknown;three brothers,
Oscar Exger of Ord, Neb; Emil T.Hansen of Burwell,Neb.,and
Gull Eager of Fon Worth, Texu.
Then: lmvlvu um alaven grand-
children and two gn a t gnnd.
children.
Funnnl nr v le u we n hdd Ihy
I
ning of the death that morning ot
Will Craven. 58, at his home in
Omnha.An a boy Mr.Craven
lived in Washington county and
attended the Maney school when!
his niece,Miss Alles French,
taught this p u t year.He was
marrie d fa Blu Co n M, Frenchand she with thw sevm childrm.
mu n m .m b a ,m m ,Glsdyl,
Agua, Adnline and Roseanne, snr-
vive mm.Four dawn, Mn. Su-nh
Lwlngstnn,Hrs.l h r y Brown,Mrs.Jnmeu Dohn, a nd Hn. Hm-
mh Hubbud; four lmtha n, Dem
nil md John, Omnhas 'rlmmll ol
laurel.and Charles at Omond,
est guarantee ever pqf back of
cpaint at $3.00 per gallon
We have sold these goods tor 25 years.
me qnggnaggwwej wunw um ur un uum rmnr lm m m m m 1=~xm m u m a n. \. .