02-05-1931I ITHEENTERPRISEWASHINGTONC0UNTy»3rmm 'mssaws-nquaeul#K |J ~*¥JN
|~..¢»
..;..¥.
PLAYS No YAVUKITEB
GENERAL NEWS OF WASHINGTON COUNTY,NEBRASKA ~BLAlR'S LEADING NEWSPAPER
OFFICIAL PAPER 0F_WASHINGTONCOUNTYI
»>r "m»u.\»aw¢e=|yuy.\»hA.n»»uS\bwrl|\iwPrlec»81-5¢verYasr.Slm¢|¢<>¢,,_;¢_
numouansnsxdnunb
W»hinl¢lount1.BLAIR,NEBRASKA,FEBRUARY 5,1931 NUMBER 3VOLUMEXXXV
Vflen It's SixBelow-Above
I
0
.r .+_....ZAg#1 ~.:ifv...§.~>1 H:gi{:.r ~I ;\>.a fl r \J.:.¢\2 ;4.\~~;g|ffi:\¢#5 ~¢u:.~~~
~..l :.~
Z .u_.§2)~i
.f~r
<5-if "\..'
&5:f}¢<
f |A >2f9¢:
.(J
p 1 I rmv
~A
Q
.{.Q .
.J g .
ff@.,
E$2
gl
~sr
§
a l.
5 ¢u\A.af!f_:if|~5~.1
.];:..4_/Hlr ~g___/.qv
/~Ifffw;;..;rv ~.1_J.
.g J .;~f .y ~:Q ..1.vJrl4.L .;.4ffCf~ra ._ J
f.Ji ..~.ff£.<~1f ~ff~ax
i
PZ
1
|
~""'?"' > '
; ~y».w=;~ff*
i ' ; » " j a w zr" ; v .i 1 .
j i f l ;i n f :
" | 7
~12"f»=ig' 5 ~ r 1
,. .. .
-
..;t ,- f . f
. _
~.-: : rl l I f ...J
».¢ »~=»_
n . " ` ;f e . . ,
( m m
nI w_..r :-~
1 ;..;;S;,;;;,; ° ° ° ggMissin;January Warmest Mbnth §°'5°"5';''§i'*;§F§.=January anRétums
"nmn Afh1r IA Yann'
January wah more the
,question .of dry election
,will be up for the decision °
January Recordsf
~lation of i.he.husseS and
January
u
cO
0
of the voters.This yurinsolaruthecityinconcerned there are but the tourcoundlmento elect.ln the
Iint wud Fred Thietje is
the outgoing councilman;in
the second Jim Roberts;in the third John McKay
and in the founh J.P..leu~
s
sl
1
»
s
n
o
s
ssen.ssoasaonooeacosof
SCHOOL BOARD MEETS
llvlnlv nmllvl A1 l\¢\|l0
/
ARLINGTON PATRONS MUST ~of Blair Couple Moumed nuPAYHIGHERPHONERATEDeadReturnsHomein6004
A commumlatiod from the able Health After ln Aboenfe of
railway commission to L. P.Mille*Fourteen Years
secretary of the Arlington Com~|munity club was read at the club SPENT SOME TIME OVERSEAS
meeting Monday evening and statIedthattheapplicationofE.C.Enlisted Under Assumed Name.Hunt manager of U12 Arlingwnl He la Now in Business in Reinllelephone company had been gmnt|beck.Iowa \.
The Blair school board met in
regular session in the superinl.endents office last Monday eveningTheearlypanof the meetingwastakenupingoingoverthelistofbillsfortheprecdngmonthand_al¢er this mn informal
\discusxion took plnce as to thu
needs of the wtool bdldings in
the line of repairs which should
nunmer vacation.I
be looked alter during the coming
ed and that he was given th
authodty to increase the rates.A public hearing was held ut the
city hall in Arlington December 22
and owr a hundred subscribers
were present to protest the proposedraisewhichwas as follows:
Business phone present rate $2
proposed rate SS:residence onepartypresentrate $1.50 pmposcd
$1.75;residence two party pres»:nt rate $1.25 proposed $1..50;
rural present rate $l.50proposed.
lvan C.Taylor ken of Mr.mul
Mrs.Jud Taylor of east Colfax
street suddenl returned home onSunday_evcnir1 after an absence
of fourtoen yours.He was indeed
a welcome guest.l lvun first left homo in 1911 and
for years was absent but in Dec;ember.1916 he returned and for
a period of about te days visitedhisparents.Whrn EQ left E:\\I\¢
Januaryoids Record an WermatiDEBA1ING
SEASON
So Far for This 1Iemitory.62 REACHES ITS PEAK
Degrees Fithat Point Resched
in January Sopt.D.V.Masser has cut his
debating squad to four members
who will.represent Blair hlgn in
the district and state championship contests.The members chos
en for this honor are:Alice Beck
rrmn Captain Reed 0Hanlon RoyChristcnsenandFredrickaMat
.thiesen.From February 1 onJanuaryof 1931 nom holds thelee d hate vill be defisi dau~.i:*Y =..Hf*\g *ggggl =§§g;f;e§;fg1m;1§;. bate.The Blair dehaters will
sos.T1 nhl s1.r5 *Lyons at Blair on Wednes11.~5.22.§.:::::;wx ~~~They ~meetCraig.:ao mu 1 ry ...with a rrlean .of 31.2 nor January goggle ;gb{;;T§¢§;1§1$§.1
~of 1919 with 30.1 but still enough f J:oe U fl d b te th ato make the high recom.1 irma we am vi e n eTheweatherbureauatLincolnPlattsmouthnegativeteaminthey\w J f 1330 th activity room of the aeniorl1igh
ZI.i3......1IT$.?.§é. othan thi:?Byen:lch .On Tuesday the Blau f(......\.l ~..__firmat1vei\team wilt meet Omaha
in:Low ZERO ONE MORNING
River Open All Winter..42 Inches
Moisture is Total for January.
February Unfns Warm
I
I
~¢
an
0
o
s
I
C
0
fu
1:
e
n
al
a
n
a
I
a
a
e
an
trucks using the #M high
ways.Regulations to place motor
transportation on a moreequitablebasis with rail carrieroisfavoredand
meetings are being hel to
assist in educating the ub
lic and bringing this about.
The move is in favor of
the railroads which aregraduallybeingforcedout
of business and which areconsidered as a real freononlic
necessity in the marts of
trade.During pe past yearmanyemployehavebeen
laid off on account of lack
of businessf
Those favoring vtgulation
of the motor vehicles pointoutthat they do not have to
build or maintain a right of
way and insist that they do
s4
o
4|
an
14
Pll
4
1|0
4
a
e
s
oI
|
an
e
as
u
|
1|
||
\
ol
hut that :axes It naex Deyunu metimethelocalwsatlurrecords
were kept,except for moisture.
lCentrai i:\l0rnaha.The week will
he rouhddl out with a moe wide
d ba toiir be h ld 1whichgoesbacktoiankeptby.e re _e a
the late P.H.Matthiesen.He
probably didnt keep them himself
but kept track of the reports from
:hc Omaha papers.The nearest January to the onejustpastwasi11R2l..just ten
year:ngo.This January had
Midland College commencing on.Thursday evening.The Blair de
;baters haw always made an excolkntshowinginthiscontest.
ln 1928 they proved to be the wi:\~
ners in this contest defeatingisuchteams as Omaha Tech Oma
h Fhighermaximumtemperature12.7 3 North SE and Lincoln to
as against 39.1 for i221 and 10.3
in 1919 the next warmest year.She minimum teinperatures wane23.3 for 1921 20.8 for 1931 und
19.9 for 1919.ln other words tho
rughts were warmer in 2921 toon
in January 1931 and :he dayswerewarmerin1931.enough to~
mnlos the mean an all»fime record
for Jie past 39 years.The hillhest point icnched bythemercurythisJanuarywas69
on the 29th.The high record was67ln1928 on the 10th.The highmarkin1919 was 62 a:d but 58
in ::»21 the next warmest Jauu
agv rn record here.
lt nas below xero but one morn
(Continued on page eight)
msrklcr BssuiriaA1.L
TOURNAMENT
In a letter from Walter I.BlackexeeutiveSecretaryof the Neiiril
ka High School Athletic Associa
tion Superintendent D.V.Masser
was informw that one of the dist
rict basketball tournaments will
be played in the Blair high gymnasiumonFeb.19 to 21.The
Blair hilh school gymnasium is
considered one of the best andGuest in the state for the holdingolbasketballcontests.The coach
es of easmm Nebraska beingawareofthisfact\0l6d almost
unanimously for the placing of th:
tuumament in the new Flair high
gym.The following schools of
eastern Nebraska will take part in
this tournament:Arlington Belle
view Craig Decatur Ft.Calhoun
Herman Kehnard Snyder Ban
croft and Uehling.Superintend~ent D.V.Masser has called ameetingofallof the coaches of
the above schools.This meetingwillbeheldinhisofficenext
Saturday February 7.At thattimetheselectionof referees the
Plirimz of teams and the real
budness concurring the mumsmentwillbeoneofthebat)1thehistoryof the Assodation.
NEWS RUM AG.oounacs
Merton Kuhr of Blair is the
editor of the new fam:operatorsnewspapersaccordingtoH.K.Douthit abort course director at
the college of agricultune.BoysenrolledintheshortcourseareNebraskafnrmboysforqsho
agriculture study during the .».3
work months on the farm.
At the same time Do thit annopoceathatMorlssCranaerofAuronaisthemanagingeditorof
the paper.Eight news reportershavealsobeenselectedtowork
vim first honors.lt is expectedthattheBlair dcbabers again this
year will make a very creditable
showing.The teams entered in
the tournament are Fremont |Valley Tilden Aurora GenevaNebraskaCityBlairCraigGrand
Island Newcastle Lyons Wayne
Nodolk Tekamah Ravenna Snyder.Plattsmouth and Cneighton!Prep North South Central Ben
;»»and Technical all of Omaha.
|
iCllY COUNCIL PROCEEDINGS
|February 8 1931*
A regular meeting of the Blair
City Council was called to order
st 7:80 P.M.by Mayor Stewart.
|the following Councilmen answer
not near a snare or tax
ation proportionate to that
of the nilroads..
The claim that a number.i busses udng state
highways carry largeag:tanks for extra
line purchased in
states to avoid payment of
the Kansas gasoline tax.
leaders in the movementclaimregulationsofbusses
*and trucks is necessary as a
saflety measure.o 4 o o
smr~
gasoother
a
o
so on
EIGHTIL GRADERS
OUT IN .FORCE
Superintendent Belford had afullhouselastFridaywhenthe
eighth grade pupils one hundred
ueor.Dnares in
U. S. RoadFunds
Federal Highway Appropriation
Gives Nebraska $1108031 to Be
Used on Federal Highways in
1931
MONEY LOANED No INTEREST
Under the Federal Highway AP
propriation voted by congress»eighty million dollars were mode
available for work upon the Fed
eral Aid Highways of the various
states.This money is dividedamongthestatesonthebasisof
shong ilockell in on hm.ipopulation area and miles of post
answer to his call for an eighth
grade examination.As yet the resuitsoftheexaminationareunknownasthepapershavenot
| been graded.
oingtorollml:Bigelow Hundahl S.D.
~Jensen Moore McKay Schmidt
and Roberts.Absent Thietje.|The minutesof the last regular|and spedal meetings were read
and approved.The City lreasurers report for
the month of January was read.|Moved and Seconded this report|be accepted and placed on file.All
Councilmen present voting AYE.
the motion carried.
|The Light and Ioe DepartmentreportsforthemonthofJanuary[were read.Moved and Seconded;
these reports be accepted :md
placed on file.All (Jouneilmen
present voting AYE the motion
cardcd.
The Stre<t &Alley Committee
report that they are having road
signs placed on west WashingtonS reet this Committee also report.that gihcy were unable to have th:tree ocated on West Street r¢~[moved for the pdce agreed uponatthelast Council meeting.Mov|ed and Seconded that the Street &
iAlley Committee be authorized tohave the tree refenbd to removed_the cost of the same not to exceed
~$20..All .Couticilruen presentvotingAYEthemotioncarried.I The Fire and Fire ApparatusCommitteereportthatthenxbher
coats for the 1 Ire DepL have been
»5=»»~=<1 as ordered by the Ooun
l
installed to connect Lot 12 ln'
lBlock 16 was submitted.Moved*
_und Seconded, that the Chairman'
of the Water Committee be auth
ontinued on page eight)
UNIOR CLASS PLAY
A SUCCESS
_The Junior class play Skidding
proved to be a fine success if/
every way.It ranked with the]high class plays which the juniorsinpastyearshavepresented.
.......~........
dates uikLaw
Supreme Conn Rules Thu Bank
Guaranty Lnw is a Failure and
Holds that the Denoailors Must
lose .
is WATCHED BY NEBRASKA
South Dakotas supreme court;Fridsywzondernned as a failure thef
attempt starled 15 yearn ago tal
guarantee depositors against lossesthroughfailureof state banks.
Declsring that experiments with
bank guaranty funds have failedcompletelyinSouthDakotaand
other states the court held that
depositors have no hope for substantialrepaymentof losses esti
mated at more than $45000000frombankfailuresinthepostwardepression.I
The courts decision mled againstanattempttodeclareinvalidthewheelin1927 of the original bank
guaranty law passed in 1915.Itre!uSed_ fo di that annual assessments should be made against|the 286 state banks now operatingso as to provide nmds for the paymentofdepositorsdthemoneytheylost since 1915 in bank fail
urea.Partid payment of claims how-A request for City Water to Never was ordered from a gh.000.000now held in the old guarantyfundwhichthecourtheldwasineffectinsolvent.
Approval was given the amend
ed guaranty law passed in 1927whichsetupanindividualfundforeachstatebankbutstoppedtheoldmethodofmakingsoundinstitutionspayfor losses incurred
by other state banks.The constitutionalityof this law was upheld.The decidon of the South Dskotasupremecourthasbeen_closely watched by Nebraska and
roads.Nebiaskas share is s11oa.osi.
This money comes to the mu
really as a loan to help build
needed highways and to relievethe
unemployment situation so prevalentoverthecountryatthis
time.
While Nebraska is not obligated30takethismoneyitwouldbe
short sightedness on her part to
refuse.It comes without interest
and ll to beplidbaek at uw;.sgoronefiftheveryineyears.on
first payment to be made duringthefiscalyearendingJune30
mas._
.The idea prompting this move istogiveemploymentthissummerandinorder to do this and to get
the states to start work at once»Congrea insists that all work
must be completed by Septemberlstof this year.By using this loan.Nebraska
will build between two hundred
and two hundred fifty miles of
paving in 1931.In 1982 we must
commence to pay back this loan.
From July 1 1932 to June 30
1938 we must pay $340000.00
paying back this loan or one~fifth
of any amount we receive.Thai
would build fifteen miles of paving.Our maintenance cost will
increase so it is estimated that onlessmorefundsareraisedfor
State Highways at this session of
the legislature we can only pavebetweensixtyandseventymilesa
year.
BLAIR Loses HARDPOUGHT GAME
Blair lon a hard fought gamelastFridayeveningto the Herman
basketball tossem.Blair hasbeen
having some hard luck in lodng
the past few games by very close
sores.The game Friday night
proved to be no exception to the
nile.The Ileimsn team got awayto s.flying start and presented asystemof team play and scoringoffensivewhichtheBlairboyswereunableto stop.At th_g end
of the first half Herman had piledup18pointstoBlairs4.How
ever during the half the Blair
boys held s consultation as tothe
I uisl.urun bllll
venes Febnxary9
District Court o f Washington
County.Fourth Judicial District
of Nebraska Convenes for the
Spring Term of Court
xznns.E.FOSTER Passmmc
i The spring term of the district
court will convene next Monday
February 9th and will take up the
work wiw Judge Chailm E.Fos
ter on the bench.
There are one hundred and three
cases all told on the docket but
only a meager portion of these will
come up for hearing.The jury ernpaneled for *hi
present term are as follows:
it G..nle|..____smf City
Chris L.Anderson...Grant Twp.
Torval Anderson..Ricl:land TWP.
Carl H.Bobs __._..Blnir qwL.A.Bucklin._..Blair Gty
J M.Compton_CuminB (ity Two
Jésse Davis .Grant Twp.
Ira J.Dixon _Calhoun Twp.
R.B.Els:\er__Arlington Twp.
~f~we .asmso cm.gr R.Hansen CElhounTwp.
Wm.}{ansen Lincoln
L.E.Hetrick.Fontanelle
Arthur Kramback Calhoun
J.L La1.ure De Soto
Blair
Twp.
Twp.
Twp.
Twp.
Twp.
TWP
Twp.Two.
Twp.
Twp.
Twp.
Twp.
Weston Long..Bert Mlller Calhoun
Geo.0hrL_.._..Richla:\d
Albert Prochnow Calhoun
J.P.Rhea_;ArlingtonJ.P.Swkes ..Herman
Gottlieb Stork....Lincoln
Minot Wilcox __Richland
Chas.Wrich ____Rlchland
'rwo-cssrnA1|.ao.m"
FARES INNEBRASKA
Two»cent railroad fares were reestablkhedinNebraskaforthe
first time since the war last Suu
day when the Northwestern rail
way put the new rate into effect
on its NorfolkNiobrsra iine.
In Iowa the new rate/prevmllsbetweenDesMoinesandAlgonaandinSouthDakotabetween
Watertown and Gettysburg.The Norm Westem is the second
line trsversillz this maivory to
adopt the lover scheduies.The
Chicago Milwaukee St.Pm and
Pacific recently announced a testof the plan on n number of local
tmina between Omabrand Chi
cago.The rates apply on this line
to som trains running eastward
from Omaha.
FORMER COUNTY BOY
VISITS OLD FRIENDS
Twp.
|;ney.w_|oumeo W meet in specialsession on Tuesday evening.At this span meeting ee bida
on the McCracken house which wasrecentlyacquiredbytheboard
und which had been previouslyadvertisedforsalewereopened.Three bids were offered for the
house and barn as follows:Dick
Stricklett 8225;C.0.Van Vllln
$410 and Wm Qdnlnn Sozo.Qmidan being the highest bidder
was awarded the bid.|We are informed that the build
ing will be moved to the lot onthecornerofFourthandSouth
Streets where it will be mad upfor occupancy.The building must
ibe moved within ninety days
TELEPHONE COMPANY
HOLDS ANNUAL MEETING
The annual meeting of the Blair
Telephone Company was held last
»Tuesday morning at the wi of
the secretary.The reports of the various funds
were read and in dl a total of $2004.80 net profit was shown for
the yenrs work.
OfficersMake
Booze Raid
Raid Made Last Saturday Night
Results in the Capture of Two
Who Avail Trial in the County
.mi
TRIAL IS ro BE HELD TODAY
County Sheri!!Sutherland Coun
ty Attorney hlencke Deputy Sher
|i1.f Gustin and Sam Swans nid
ed the Ben Mehianigal home last
Saturday night and arrested Molldanlgsland Cham Beard both ofwhomareinjailawaitingtheirtriadwhich is set for today (Thurs
day).|It is reported that a jug contain
ing liquor was taken in the mid.
HORSES SELL WELL
Alex Christensen of PotterNebraskabroughtinaloadof
nlnetem horses lust week which
he offerai at auction last Tues
day.They werean exceptional
bunch and brought l good priceconsideringthepresentdepression.The avenge price was a lidle
above $66.
Alex has been out in Bannercountylor the past four years andiswellsatisfiedwithhisnewhomeHelsfarming800seesof|»...s and had a good aop this
rear-His brother who hu been
there for A longer period is farm-
ing 1800 acres.
Joe Anderson of Powell Wyo.||EgMAN KETZLAFF
PARII SALEwhohasbeenddtingfriendsin
this vicinity for severd days wasa welcome visitor with the Enter The Enterprise printed the billspriseeditor and wife Monday.Joe for the Herman Rem farisaformerWuhinrwncou:ityi|e which wail be held Saturday.
52.cThecommissiondidnot sanction
~the above schedule but substituted
the following:business phone one]party 33: residence one party $21
residence two party $1/IS;rurali
party $1.85.
on also ordered by the com\
mssion that these rata should not
become effective until the proposedreconstructionof the nxral dis
tribution system and the exten
sions in the city distribution swtomwerecompletedandinspectedandapprovedby the cornmlsslons
engineedng depanrnent.
MILK cows ARE
VALUABLE ASSET
A Washington county farmer
living in the lDennan trade terri
tory stepped into County Agent
Beo.Bates office Saturday morningandwantedtoknowifwcwerenotgoingwhaveanactive
Dairy Herd Improvement Associ
ati n next year.When informed
th there would be an active test
in dhopciatlon this farmer gave aalofrelief.
s farmer was Ernest Lang
and in his own words stated that
My milk cows saved my hide last
summer otherwise I would have
been a cooked goose.Mr.Langalsostatedthathisherdofiust
average cows brought in thirty
five ($35.00)dollars per weekevenat low prices for butter fat
Mr.Lang as well as many other
Washington county farmers mydairymenhaveestablishedagoal
of high efficient production from
their cow herds and they would
not like to see cow testing dis
continued.However.as was statedintweekthatinviewofthe
present financial depress we arenoturginganyonetojoinourDdryHerdImprovementAssocii
ation but it will be in operationanotheryearforthosewhowant
it.
DEFORESTING BLAIR
The burning of wood has been
quite prevalent in Blair this win
ter and while it has made mighty
tough sledding for the coal meniithashelpedtokeepthehomei
fires burning without materiallylesseningthebank accounts of the
householders.l
lxddentnlly it su also ww to
rid Bliir of a.lotofold trees that.
have really become dangerous onaccount of size and age. The wood
mu\s axe has been busy and
while the coal dwer has suffered.
the hardware men tell us that the
duuand for saws axes wedges
etc.has been the greatest for
years.It is quite a common aight while
driving about Blair to see huge
piles of wood ready for the stove
and makes one feel as though liv
ing some thirtyfive years agowhenwoodwasthecommonfuel
and coal was only for the rich and
gy \>\==»=5=and gas stoves un
......»..
wlth th e us ua l de mo ns tr atio ns orlovea n d li ttle d i d th e pare lfts
th in k th a t fo ur te en lo n g y ea rs
wo uld elapse before th ey wo u ld
see ldrn a gai n.
A f t e r le avin g h o me he a g -
appeared f r o m ei gh t a n d wh e n
th i s c ou ntry ente red th e wa r 'he
enlisted und er a n assu med na me .
H e served hi s c ou ntry ove r seas
fo r ni ne te e n mo nths a n d wh en d is -
c harged return ed to Reinbec k, Ia.,
wh er e h e we n t in to business a n d
wa s ma r r i e d a n d n o w h a s a li ttle
da u g hte r do u r y e a r s o ld
wlth honored him by choosing
him
as the head ol their organisationandhe stands high in the budness
and social activities of his home
where he is known as James C.
0Brlen.Why he adopted thename
OBrien he did not offer to explaintohisparents on his visit homu
and no questions were asked him.
On enlisting in the army he fol
lowed the inclinations ol the Taylorfamilyfor,of seven sons six
of them saw service in the World
War.
Mrs. J.P. Jensen of this countydeserves much credit for the find»
ing of Ivan Taylor.It was she
who gave the glad tidings that he
had been found and it was throughher than he was stirred no see his
homeand parents once more.He remained nt home from Sun
day until Wednesday when he retumedtohisfamilywiththeassurancethathe would shordy retumandbringwithhimhiswif~
and dauhter.
There is great. joy in the faylo
household.For years the son had
been thought dead.Many were the
conjecturesaof what had happenedtohim.There was no questiobutthathehadenlistedinthe
army and naturally the only explanationwas.that he had methefateof thousands of other~
and slept in an unmarked and unknowngrave.When he suddenlreturneditwaslikeonerisin~
from the dead and the parents and
brothers and sisters are yet daze~
over the event...
f`¥=§
1 ~1 | |1'
- t § £ E ' ; » § ;~
a : . * `y .__j
:u M
f¥=§
nl2
89 I625
kt
1522
Feb.
1 February\¢.in \1
5 4 510ll12
I7 I5 I9242?2?
193IIll5
6 7
I3 I42021
27 28
n I
*~~<f.z§f7
6 Aux.entertain Legiam aSchelfkfnhall.Feb.6W.R. C.kendngwn wilMrs.John McQuurie
Feb.I Dance at Kingfs pavilioFeb.9Arouan hog sale at ..
Valley.Feb.10Carl Petersen saleFeb.11 Andrew Beck saleFeb.12 Emest Schmidt hog 531FremontFeb. 13-mum a Ruseada.
f¥=§ATES MAKE GOOD
(Las|weeks School Nates)We are alwnys pleased to he~from our graduates of Blair Hig
Reyently Superintendent D.V
lhaser received an atmnouncemen
that Curtis Mlyhlrd.a graduate <theelnn of 1980 ls now holdingflncposifioninconnectionwi
~the Bloomingdale Hospital at Whl
Plains New.York.
Chnrles Eliassen is also holdin~down l good position at Norfnl
We understand that he is managvrolalocaltheaterandassidelinedoessomebroadcastin~
over the Norfolk station..
I
\
In the new
publication.Original plnn.x call for the publicationofwenewspaper in two
editions between now and the
middle of Much when school in
out for the short course boys.The
first publication is expected bo be
out by next week.Copies dll be
distributed to every fnrm boy lt
tending the short course.Mr.Kuhr is the son of Mr.andMm.George Kuhr Jr.of this
county.
AUTO ACCIDENT
Wilbur Russ pf Council BNHSIowaincompanywitha couple of
young \ady friepds came fo gdef
Saturday night when his car skid
ded inm the dich longside ol the
road and tumeii over and beforehelpcouldunitethecuburned.
The uddent occuned an the
highway between Kennud and
Arlingtnn and the ymmg mln wassobadlybatteredupthathewasbroughttotheBlnirho|pifa|{k0I
treatment.He was taken to his
hame in Council Binds lut Mon
diy.The Indie:w=P¢d without seri
ous injuries :ma naiving a cutonthermandtheethergotng
annmng ls I.ueugnuul comeay
on American family lile.It pre!
sent;a from secEun of the happening;in the avenge American
home.It was modern in everyway.The cut was well balanced.
It was not what we might call astarplaybutthesuccessofthe
play depended upon the fine team
work of the entire cast.Mary
Mulliws impersonation of Aunt
Milly was excellent.Reed 0Han
Ion was axcellent in his part of
Andy.Judge Hardy portrayed byGordonVintonand Grandpa HardytakenbyFredrickNerpctzwerebothexcellentinthi.;line of
dalacter portrayal.Mrs.IIdrdy
as illustrated by Ilomnce Curtis
was a typical American house
wife.Ruth Iarnhxm as Estelle
Handy Campbell and Hue]An
derson as Myra Hardy Wilwx
pxvved |150 adept uztressu in
their parts.Helena Simonsen asHuionHxnlyandRayChlilmz
sen ns Wayne Trenton were the
leads in the plny.Wpodrow Svend
gaard prennted A skillful portrayaln!Mr.Stubbinl n modem
.city palitldan.The vlly wu mesentedunder the direction ol Hin
ladle Kemp md Mina Hutchinson.
The.hlghaehooi onheum render
will have a great bearing on thedecisiontobe made uf this ques~tion in Nebraska.
EARLY DAY CITIZENDIES IN EAST
Word has been recdved byWashingtoncountyfriendsofMr.and Mn.Phil Gossard early dayresidentamufBlairlongslnnede
ceased at their grandson J.B.Gosmrd of Medina Ohio was in
nantly killed there recently.The
dased was born neu Blair in1
He is zurvived by his wife and
seven children ol Medina and his_parvum Mr.and Mm.A.P.Gov
hard gg Wnyne;rdNeb;four bro
era r..Gomrd otlmAngeksEarlof Valiex Mun?anal|Kelly of North Platte Nab.and|Theodore of Ggallnla Neb.and
one mister Mrs lhhd Sorsmen ol
Wayne Neb.
I
ERNEST spmmrr HOG SALE
Emelt Sehmiuyj master tmnex
of Dodgn wunty is to hold n purel
.lard hog ule on his fuIn nurFremont on Feb 12.Mr.Schmidthnreallnrmarmdhnhutferl
bm method uf stopping the at
tark of the Herman players.lr
seemed that when the turn went
back inm the game the second
half it was a 100%different organizationthandudngthefirst
pm of the game.Blair commencedmscoremorefreelyand
during this part of the game Blair
amassed a total of 12 palms onthevisitors8.Buton account of
the dniwrs long ledd in the first
hull the game was tallied an a
victory for Herman.
OLD TIMER CALLS
ON BLAIR FRIENDS
Stanley Davies son of Mr.and
Mrs.L.K.Davies of Lincoln wascallingonBlairfximdslastMon
day.Stanley in 1 native of Wuh
infhm county having been bamnndreuedaznxfumontinthe
Sutherland school district wut of
Blah.
A nugnber of yan ago the
family moved to Lincoln and nm;finnlnllinx his eduatiou Stanleybecameinterestedinthelifein
nlranca bmrineaa and is now well
nptownndtlaefapinthntlinu.
bvy leaving Nebraska deven
years ago and this is his first triphack.He reports the other membersoftheAndersonfamilywho
are also near Pcwell as I and
swirls nlfmg nicely.
They/have had the same mild
wintef there that we hnve experiencedinNebraakx.Craps last
vw were good their major cropsbeingsugarbeetsbeamandpotatoes.Their farm land is underiheirrigationsystemsotheydo
not worry about morlntum for cmpu.
WRECKS AUTO
Oscu Petersen returning from
Dum College on Nebralkl streetInstMondayhadanaccident
which wrecked hi!mr md tamthefendersof!a delivery truck.
Nebraska sem:and at the street
vvpodm the old nite of the DextavillestunthetruckccmingsouthwasturningintoNebraskameetwhenthetwoanmmeMtvllier.The Petersen cu burnedpompleklyoverandwasnwh!wmk whils_un exuk nmthefenden:tri fmm one
|Febn|.ury 14 at the Raman farm
near Washington.Herman huan
exceptionally big offering olhighclassfarmstuffwhichwillbe
closed out lock stock and banel.He intends to quit farming and
will dose out everything.
mn:nEsnNG NME5
FROM THE maoolms
During the past week the conntyclerkfiledfivewarrantydeed:
mostly ol small dwa.One ofthesewasthepurchasemadebythecityof the Leslie Olkn land.
Four nd estate mortgaga werefledand one real estate mortgagewasrekued.Thirty chattel mort
gages were filed and twentytwo
were released.
COUNCIL Acc::ns PLANS
ron svmnmm POOL
The city council met in regularsessionlastTuesdayevvlinzand
went over Qhe plans and spedficmHanafor the xwhzming pool which
is soon to he wnstmctcd.Amr A arefud consideration ot
the mmf the sound néoe md
Petersen was driving ent
dds.No one vu injund.ptheplumnndimmediatelyordered
entix~¢ly_fxge._.4 appxvptiaw muh.ins some mighiy md ma.Mmm in nn hmm *nm for of
Advunhe in Th Dmrpxiu.tha contract lor the work.
»~»5m ul.
GRADE BASKETBALL
TOURNAMENT AT DECATUR
Hue high school authorities at
Dmatur Neb.an sponsoring Igradebn.sketbal\tournament in be
held in that city next SaturdayThiswumunentisopentod
pupils in the 8th grade or below
A boy must also be under 1_(years ol age in order to plr6d<
pate.N basketball team made ulfromstudentsinourjuniorhigl
school will probably repmaenvBlairinthisbasketballcontest
Mr.White principal of the Juniol
high sbhool will aaompany ancmanagethe team at Decatur.
CAR STOLEN FROM
PARKING PLACE
Timm Tucker.son of Mx.amMrs.Harry Tucker who live nord
of Biair is minus n Model A Fon
coupe.He wu in attendnnee a\
the Catholic ard party held Wed
nesdny evening at the Paris!
Home In this dtyund had ldt hi:
ur parkod in the lreet in front oitheParishHenle.When he.um4
outth»e nr ~NIL atthepresentwritlngnoUn\|1h|1beenlwldv!lt.___.__ _
__
Ieb.14Herman Retzlofl sale
ntWashingtonFeb.17Henry Misfeldt Sale at~Kemanl
Eeb.17Art Purse nlq at Wuh
Feb.20Ham C.Sonnnmnk dt
Washington.
I
Nebnska, February 5, ma;
.PIU Two
dw n i g ht s wf o f M i x : Ir e n e ~
er n.L and Mn. Lars Rolland andclilrlren spent Mcnday evening at
the Chris Wrich home.
Mrs. Chris Peterson was a Fri~day afternoon vidbor at the Rnd-olph Andreaeon home and A Mam-
day guest at the Martin Paulson
home.~Miss Edna Nerwkirk arent Set-
urda night with home olkx.OnSnmyshe' left for North Bendwhen .she u working et the 'Pd
Moyer home.Bobbv,little son ol Mr.and
M n .Merle Newkirk was quite
dak with cmup last week.Mes-
a me s Boone Newldrk and Chris
Rumussen helped care for him.
Alfred Jensen of Blair, and Roy
$55 at tha Chulie Rogen ho~
'le the msn lolkl attended th~
Weber ule.Mo s t o f th e ~ f o lk s i n --vicinity ntten od e basketball
game in Blair Fr1d.\y evening.
week-end at the -s Petenon
I
Wool and Velvet Benets, vain
up bo $1.50 now on sale at the
Fnahlon Center for 89s. '8 4
Clearance Sale-Silk D =~
~Values to szo gn at $7.95 c n:
Values to $10 gn lt $5-sizes 11
to 46.Fashion Center.8-1
Silk Stockings that Wear-Go!
Strlpg $1.50 and$l.95; Onyx $1.85
full fuhlo nd dll: to to p le rv l~
or chiffon weight. 77c; Neverdnrn
2 pair Sl.Fuhlon Cutter 3-l
Frank Sd.\a!er'|.
Wnlter Wachter of Rosalie,
alled an hla brother,Clarence
Wachter on Honda .
Sevenl from vicinity nb-
tended the Blair Co-operative
Creamery Co. meeting Tuesdny.cha. Vindenlev hdped Hull K.
Jensen butcher Wednesday after-
n o o n .
Mr. and Mrs Wm. Christiansenmd Bergitte were in Blair Tuca-day.Mn. Chrlltinnaen had somedental work doneMr. and Mn. Clarence Wachterand children spent Thursday eve-
:ing at the Mrs l Llzde Adennan
ome.
Louie Hansen called nt Chi ll
Vi:|d¢nlev's Friday forenoon.
Herman Petersen of Arlington.
w u n dinner guest at HowardWill.lnm.sen'n Snndny.Fred Rngen trucked hogs forJohn Rogert Sunday evenlng.
John Reel:ancompanied Lodeglzmsen to the Weber llle Thurs-
ay.Mrs. Clerk Browning visited the
Thane school Friday aitemoon.
Mr. and Mrs. Clmremae Wnchhk
and children called nl the Carl
Culberg home near Telbaah on
Sundan afternoon.U Q Ill: Anne Thone in havingthe pink eye.
Mr.and Mrs.Fred Knbie , lo
compnnied Hr.and Mrs.PeleChriltllnsen and Rsymtmd to Omn
ha Monday.
Mrs. John Rogert md Doris nd. K. Anderson apent Thurs-
the ~office of the City Clerk at
»--:~| o'clock
h u -...»-- - »
NOTICE To CUNTRACTORS
¢_n»nunu»
" - = "u
Ras mus sen c elebrate he r bi r thd a y
W ednes day eveging.
/~I
I
:
fu;\\y ¢5:£&Ii¥»R'\' for "Pg" the
following guutu._ yr. an __ Mn
m e , m r . n omd childnn_N U T I L E U I B U L L " ' " " " " ; ; _~~~O I . g d ~ g g ;~L a r g g n - n d ;
.I ve : - i s a n d s t r u c t u r e s o r w o ". m m .I L n 'd* ; " .f'. ? . '. § ". f ; ' . ; ' } ' ¥ . 'l.'§f.'..°"..,. . , , .c u . , .. . . a n n 1 v = ° % ' " ¥ § * °c o n s t r u c t =' m u o n c q n c r e t e u r .a n d M r s .H c s e n a n 1
... - - \|A....0n . . » . . - . 5 n n n . .....~.I l l a n l i fd H a n s e n a u t o e d md Bergitte were in Blnir Tunedey.Mn. Chrlltimlen had somedental work doneMr. end Mn. Clarence Waawrand children spent Thursday eve-
ning a t the Mrsl L izde Ademunhome.
Louie Hansen called et Chris
Vindenlevk Friday forenoon.
He rmm Petersen of Arlington.
Lowest mucus
In Ou
USED CARS With
rl 'listory On .
An o. K. That COUNTS
Now ls the time to buy and sav e money. Come In and
look over
1929 Chev rolet Sedan
1929 Chevrolet Coach
1929 Ford Coupe
1928 Chev rolet Coach
1927 Oakland Coupe
1928 Pontiac Coach
1928 Pontiac Coupe
1927 Ford Tu dor
our USED cm STUCK
1 9 3 0 C h e vr o l q C o u p e
19 2 6 C h r ysl e r C o a c h
1 9 2 7 C h e vr o l e t T r u c k
19 26 F or d Ro ad st er /
|9 27 Fo rd Ro ad s te r
1 9 2 7 W h i p p e t S e d a n
1 9 2 9 W h i p p e t Se d a n
Lo t s O f O t he r s
Open old cars taken I tra de.Easy G. M. A. c . TERMS
If you are In the market lor a good used car at a bargain we hav e It
eV m t o n - E v a n s C h e v r o l e t C o .
Fnahion Center for 89s. '8~lt
Clnnmc e Sale -Si lk Dre ssa g-
Values to $20 gn at $7.95 c n:
Values to $10 gn lt $5-sizes 11
so 46.Fashion Cenfzr.s - u
Silk Stockings that Wear-Gold
Strlpg $1.50 and$l.95; Onyx 5135:
fu ll fn hl o nd d l to top lervice
or chiffon weight 77c; Neverdxrn.
2 pair Sl.Fuhion Cutter 3-1
Mr. and Mrs. Curemae Wnchhkand childnn called xl the Carl
Culberg home near Telbnta on
Sundnn afternoon.UQ Ill: Anne Thone La having
the pink eye.
Mr.and Mn.Fred Knbie, lo
compmied Hr.and Mrs.Pak!Chriltimsen and Rsymtmd to Onan
ha Mondny.
Mn. John Rogert md Doris nd
-. K. Anderson lpent Thurs-
wr n-1 .......-..-.. ...- _.V _devixeea, legabea, penonal npre
aantativu,and all purwns inter-
ested in tba Estate of George P.
s w w m ,a me n d ,mal names
unknown; and all persona having
or claiming any intaren in Ln 4
i n B h e k 6 9 l n t h e C i ¢ y o f B l l l r ,
Nehnskt, nal names unknown.
Yun, and each ol you,-are hereby instilled that \-be Gunn: Sav-
i w w h » f B ! - s » , 5 i ° ' ; ~ ' = --
xpecilxatiom heretofore adopted
by ihe County Board of Walkin!!-tan County, now on [lb in the
County C|¢rk's Office o f W uh-
lngmn County. at Blair, Nebraska.-
Bida :hall he asparata on each
different una and dau ol bridges,
approaches Ummm,and on each
wlvert or impmvament of road.
m d shall be sealed and ill-
ed m tha offloe of tha c m w
m-..\.-v n m mnntv on o r
awammmg pam,"nv .........-_frame bath house and 490 G.P.M.
Perkin; Vacuum Rapid Sand F\l~
far, dry gallery type, together with
all acavation,gnding, concrete
work,bundmg ronstruetion. pipe
work, Plumb!-nz. sewers and elec-
tric wifi!!-Section 1Allexcavation,grading,con-
aete work and building eonstruc~
am. ranulxed m complde the pro-
I
nn....u ........_. ..._____,__to Fremont Thursday when 1hey\
vidtad Mn. Rob Peterson.'Mr.and Mrs. Peter Taft ofFremont,spent Thursday and
Thursday night at the Ray Pager-
quist home.M n .Mike Ingeralev of Bl ur
was n Thursday guen ot M m
Lodse Larsen.Mr. and Mrs. I-'td Eager, MinsMildred and Howard of Hermanyeng_S\1nday dinner guata at the
Ra smus se n ne lp e u ca n mr n un .
Alfr e d J en s en of B lai r , a nd Ro y
P e t e n o n o f Omn lm,spe nt th e
week-end a t t h e Ch ri s Pe te rs on
home.l | \ \ . . . .. . . ¢ ¢ ; » » \l » . . . . 3 ¢ . - . . .u 4 ¢ \ |\ r v . n l°*"°*I"i".E" g§_=_=";\§=I;;_"'I;m__,;lB'°"EB§¢ "iz ;T§ocf.H,_g§ f»=|§¥.'"°"I Hagdxv evenni;;w$U¢i¢8 at the
Ar~UC'l'IONEERS
BnADLEY&sEA1uNGOAKLANDT EKAMAH
Phone 193 Phone 143 or 11
The large number of sales weare conducting
is the best evidence that our work is sat-
isfactory.
Don't Forget We Pay Pho ne Calls.
'"§'§T§"i"i"1'Ti'""f"~. 0
/...T0......BLAIR
FEBRUARY I9-21, 1931
What?What?
Something new
in display
Where?Where?
ARNDT n §NYDER
.a ..
|mu-.vu .»- -.--~ - -- ~d,of 1.-,\»,nm»y, um. um Sedlanz " ' " " ''' h use umuu uunmvw ...nu--5 Wm m q f w - m m m ~ T i k my nwffmnmlul by a =°""All vim work,v""" "'"'and £i'°1'Z.'5 Mrs. wil again .na U"C°'"°"'Y -"'°°'*"°",b 'g
.ro -""'2'.. a'§::n§,°§mp1m¢a vim sea mm for $600. or wh- vu nun w mmnlf/M1 tha P l°°'Hr. and lin. .uhm Jemen and §'?'2 __v,_m_.n at e
¥1'1'.__n.. .nun ...A nnve: of .bu no zhecounty Cl=f¥°f'?"Pv swam s __el1i1dx9H-. ..... _mf. And Hn. mmf Taft oh
ounsrs,t m w p --- - .- -- .~which aetian is to for-eclose a
eertain mortgage given to theplaintiff by Nellie E. Bnliibllllh
and En-a A.Br-ombangh on the
roth day of May, 1925,on theabove dudribed red emu. which
aid mongage n recorded lnBook
15 at Page 190 of the Moff~8IFRecords of laid County,and de-
e la ri ngtlns a me to be a fi rs tli o n
on said real estate, and dsc ony-ing for costs and other equitable
mllef.sam petition further alleges
that any interest ln or lien upo:\
said real estate which you or anyof you may have or claim to have
is junior, inferior and subsequent
to the plaintiffs lien.
You and each of you are re-quired to answer said petition in
the District Court of Washington
County,Nebraska,on or before
the Zml day of March, 1931.
Citizens Savings Bank,uf Blair,
Nebraska, Plaintiff,
By A. c. Debel,
1-4t Ita Attorney.
ington County,Nebraska.w onforfeited to tho county in use bld-
der refutes or hill to mto! into
n contract and give bonds in msn-ner or form as re qdnd by the
county, i n an the eonrnct be
awarded to hkm The number andum of bridges to be som and the
proposed location will be in ac~
eordnnce with the direction of the
County Board of uid County. from
tirm to time;all bids will be
opened at the hour oi 1:00 o'dock
p. rn., in the County Commission-
ers room, and the Board reserves
the ight to rejeat any and all
bids to award contracts for diller-
ent kinds and classes o! work todifferentcontractors;also full
power to throw out blanket. col-
lective or defective bids _
(SEAL)George C. McQusrr\e
5241;I County Clerk.
o n E ' r o c n mr r o n sNc/0 F ESTATE
0'l-lanlon and O'Hanlon, Att'ys.
,.......¢~ nnrvwr ws szmNG'r0N
All eleetrlc wiring,both powerand lighting to complete the pro-
per.All bids shall be made in accord-
ance with plans and specificationsnow on file in the office of the
Engineer and City Clerk.They
will be received only on the type-wrltten forms furnished by the'Engineer for that purpose.
All bids shall be sealed and ac
eompnnied with n certified checl
drawn payable to the City Clerk,
Blair, Nebraska, for five per cent(5.%) of the tottl amount ot the
hi d This amoun shall he forfeit-
ed by the bidder, ns 'liquidatingdamages in the event the bidder,
within ten days, falls to enter into
Contract and post the. bond re~
quired, obligaling him U0 complete
his Contract and sustain his guar-
antee for one year.The amount of the bond shall be
100%of the contract price.I t
sw! be executed by a responsible
Surety Company licensed to do
|...=an»~n. in the State of Nebraska.
I
Friday evening visitors nr maWill Wulf homo were Mr. and Mrs.George Wulf and family of Arl-
ington, Mr. and Mrs. Richard Nol-n and Mr. and Mrs. Hana w..o.\
Mr. and Mn. Chrla Benson spent
Sunday at the Joe Jessen borne.
Mr.and Mrs. Richard Nelson
and Viola and Mr. and Mm Man
tin Nelson of Bldr, were Sundayevening guests nt the Fred .Jen-
sen home.Mr. and Mrs. J. P. Larsen ofBldr, spent Tuesday at the Peter'
Nielsen homeAplayThe Wild Oats Roy
was given Thursday and Friday
evening st Bisbee school.The pro
ceeds were $30Sundndinner guests nt the
Mrs. J.P.Andersen, Evelyn and
Florence and Rev. and Mrs. Hans
Jersild and children of Blair
Tuesday evemng guests at tho
Ed Newkirk home were Mr.andMrsJPLarsenofBlair,andMrand Mrs Peter Nielsen
Mrs Marnie Shearer and Jens
Iverson were Sunday evening
|Prornont, and Mr.and Mrs. Ray
|Fnx¢rqunt were Friday afternoon
visitors at the Rudolph Andreason
and Chris Benson homes.Thursday aftemoon visitors at
the Fred Diekmeyer home wereMrs.John Dlchmyer and MrsHenri! Dickmeyer and Esther, Mr.and rs. Ed Hansen were Fridayafternoon mllers.
Amos Andreason of Lincoln
ment Monday st the parental.
Rudolph Andreuon home.J,P
Andersen and R v Hana Jersild ofBlair and Peter Nielsen were Sun~dsyi nf!/emoon callers there.iss Helen McMillan of Blair,
spent the week end with her cons-
xn, Miss Dorothy McMillan at the
Fred Dickmeyer home.
YORK CREEK NEWS
Mrs. Jens Jensen and Gene of
Blair spent Monday with Mrs.
Andrew Alback.
Mr. and Mrs. Soren Jensen and
Janet and L. P. Skov visited at
n 'n vPeter- N lsen home were Mr.g '.
nes ts at the Carl Rasmussem
the ~ V. hewkirk home Monday
evening.Other visitors were Mr.
. .. . » -- - - - »- * - - - - - °N O T I C E O F s u s m r f S A L E
I n th e Distric t Cou rt o f W as h-
ingto n Cou nty , Nebra ska.
B y vi r tu e o f a n order o f sale
iss ue d ou t of th e Di stric t Co ur t of
W a sh in gton C ou nty , Nbr us ka , an d
i n pursuanc e o f a dec ree o f said
UUULYL 1. \..vVuu;,\¢n\.»»--.1- .._U N T Y N E B R A S K Ac o IEs ta te o f No r ma n W .W i lk in s,
deceased.
No ti c e i s g i ve n to the c re ditors
to a p pe a r be f o r e me a t th e C o n n -
ty C ou r t ro o m in B la i r , Ne b r as k a ,
on the 2 0th da y of F eb ru ar y , 1 93 1
a n d o n t h e 2 1 s t _ f l e y o f M a y ,1 9 3 1 ,
""- - - - --n u - u - » : o a * ; 1 n n e n ,
- f - - - » ¢ - . . . .- -..__.It sh a ll b e s u bje c t to the a pp r ova l
of the Own er a n d th e En gi ne er .
Certifie d c hec k s o f un suc c ess ful
bidders wi ll be return ed wi th i n
twen ty - fo u r h ou rs af te r e xec uti on ,
and ap pr ova l by th e Own er an d the
En gi ne er , of the Co ntra c t with th e
succ essful bidder.A l l bids a n d
....»..\»la -hull Rn awfn;I nnnh with-
ho me .
Mr .
n a h a
Ed Hz
Sunda
J ens
ma n .Mr .
dnu gh
ilin .Ta
and Mrs H C... lmsen.Han-nd Louise and Mr. and Mrs.
msen. Anna and Esther wereA'aftemnon mlests at the
Jcspersen home,near Her-
and Mrs.Ed Hansen an<\`\
...
a n d Mr s . A lf r e d S k o v a n d Ly le.
Ras mu ss en Bro s.tra c k ed c attlefo r F a y J o n e s Mo n d a y e ve n i n g .
Mr s .F r e d K u b i e spe nt Mo n d a y
af te r n o on wi th Mr s . W m. K u b i e .
E m i l J ensen baled s tr a w f o r
W m. K ub i e W ed n es d ay .
Fr ed Krabi* :ment W ednesda a t
|=\oBE|=|'rs ~ ROSE
|~.||I
SA L E S SE R V I C E
0
nd
|
1
]lS. Wdmore, and National Roofing De 10rt:veruq1.|.\:u._wr or Lelepnune CUuul|u»m;u.uuu.Valle s nt 3 d --.C0mP¥U\5.'11 corporation,are De~__¥.'f"'°d thas 24th da of Januar),Bidders who desire plans andlthele"P9 un ay ememng
fenda nts,1 vnu n t u n e uc wc n .auv4»P. M. on Mon d av th e 23 r d d ay o f I ( S EA L )E L L E R lsp ec ulc a uu ns w r uselr P " " * ' " " " |J ens Ha n se n is stay in g a t Ihr_C.... 'usp m a v ob ta in th e m f r o m Th e Ru d nln h Andre ason ho me as Mr .
i=2=1=T»i=h,@. "im In t}1e West F'o:\t 24:County `]udge'|f'k Laborator§e§, Omaha, Near;x;a;§g»ajH.;"se;nq.;ff Ei: §e+
Door of the Washmgton County -raska by deposatmg $10 00.If eral weeks..CODE H051Bl! in the City Of Blair,~ T O ~u.......,..l........ .....:|.........:J':....4:........ n\n\Mr.nm*Mrs:Ryu'Fnvnrnuuh;
days f~m the date of the letti:1g.'t n;"'B 'fd ,§1°Y''r h°m;=g g "
a r e f u n d o f $ 5 . 0 0 w i l l b e m a d e .|e s u g f ;t h e § ¥ e § ' ° r ; . a g § § q u ; ;
T1 1 8 r i g h t i 5 l * € 8 8 l '\ '8 d b y UIC !h o m e ,n e a r V a l l e y .O w n e r t o r e j e c t a n y a n d a l l b i d s , I M i s s H a z e l N e w k i r k w a s 4 S u n
Ar~UC'l'IONEERS
BnADLEY&sEA1uNGOAKLANDT EKAMAH
Phone 193 Phone 143 or 11
The large number of sales weare conducting
is the best evidence that our work is sat-
isfactory.
Don't Forget We Pay Pho ne Calls.
IJ nna J e ttic k Shoes f o r W o me n
ar e s old b y the F a sh io n C e nter . lt
Clearanc e Sale~-~Silk D r e s s e s -
Va lu c s to $20 g o a t $7.95 arm
Va lue s to $10 g o at $5 - -s i ze s 11
to 46.Fash ion Center.3 - I t
tlonlalmuku you feel tired. dupan d xc ou ng e d. try th e Cn tax Tut.W o r k ! f m , : t a r ts c lr c u h t ln th r uthe sy stem n 1| minutes.led bythou nndn for rap id a ndc mltlve nc -tlon.. Don't 3110 "g lto x ( pr o -n o u n c e d B lu - tt!nr . u n de r th eI r o n - C lld Gunrnntee.mm . q u i c k l ysllny tha n e ond ltlonl. I mpr ove re st-fu l alae n an d mu lti . or mum! ba c k .
ject in part by section.g
The Engineefs estimate of costof the proposed.work is $21000.00.
Dated February 4,1931,by;
order of the Mayor and Council ol
the City of Blair, Nebraska.
(SEAL)C. E. Krause;
s m City Clerk. ouln~
xrInqu
I
1
Known as Robens U Rose Ranch
One-half mile north and one-half m il e ea st o f Ma in
Street of Blair, Nebraska, on . . .
F R I D A Y
FEBR'ARY 13, 1931I
Sale Will Start .at One 0'cloek Sharp
13-HEAD OF HORSES AND MULES-13
One tedabrn of Black Mules,smooth mouth, wt.
27One team of Black Mules,smooth mouth, wt.
One team of Molly Mules, smooth mouth,
One team of.Sor1el Mules, smooth mouth,
One team of Mules, 8 and 10 years, wt. 3030
One .team of Horses,bay and black,smooth
mouth, wt. 2500
One Saddle Horse, smooth~mouth.
Six Sets of Concord Harness
MACHINERY
One 10~20 McCormick-Deering tractor,with
Plow
One 2-row Tractor Lister
One 6-foot cut Tractor MowerOne McCormick-Deering single row Corn Pick-
erSide delivery Rake
One McCormick-Deering planter
100 rods Wire
wt.
wt. .
One Press Drill with grassseed attachment
One 10-inch Stover Grinder with Elevator
Three 2-row Go-devils
Two 3-section Harrows
Two Discs
One Dempster stacker
Two Hay SweepsTwo Hay Rakes |
l
II
One P. & O. Corn Planter ~
I
'I'wo Wagons with Racks
One extra Rack 1Three Wagons complete
One extra WagonOne SpreaderThree 2-row Dempster Cultivafors
One listed Corn Harrow
One Wheel Scraper
SliDSTwoOne 14-inch Walking Plow ~
One Gang Plow ..
One McCormick horsedmwn Mower
Two Walldng CultivatorsOne 1% H. P. Fairbanks-Morse gasoline engine |
Two Corn Binders
Tools, and other articles too numerous fo men-
tion
_TERMS: See your Banker
BRADLEY & snAn1Nc, Auctioneers FARMERS STATE BANK, Clerk.
'"§'§T§"i"i"1'Ti'""f"~. 0
/...T0......BLAIR
ORUM BnmFS
Mr.and Mrs.Rob RasmussenInd children md Mr. and Mrs.Peter Nielsen helped Mrs. George
FEBRUARY I9-21, 1931
~W h a t ?W h a t ?
E Something new
§in display
§W h e r e ?W h e r e ?
=
ARNDT n §NYDER
M 0TOR c OMPANY
B L A | R Ford Producls NEBR -
adder ~
eakness
~lung U rqghf Bmknchq,¢Nno§umlnz. 45. to m¢J5»`{-
n ..onxyeoau ~...
THE BLAIR mum
COMPANY
Washington County,'Nebraska,\
"U at public auction '° *~"° h'?"'Sealed was win be received ui
£§¢f5§$'§',f5'¢§El Q;;w§g}1°»»= the office of the Department of
"Lo 'hventy-five (25)§n s n ,Pullc wy<>f15g.in ~ S£a!f'H0\|
Founeen (14),Township at Lincoln, Nebraska on renmary
:wen ( r n .R87\Ke Twelve 21. 1931, until 9:00 o'clock A. M.,
n m Ffmnt of th|E ~P .M . .~. I . .L L - ..l... .. .. ..u n n l \ { | ` ¢n 0 n U n x '
Washington County,Nebraska,which lot is locatedupon the
Northwest Quarter of the North-
east Quarter of slid Section and
is described in the field notes
on file in the intersection of the
County Clerk's office of Wash-
ington County,Nebraska,as
follows to-wit:Commencing nt
the intersection of the County
Road with the section line naartheNortheastcornerofthe
Northwest Quarter of Section
uno at umm.uxne yoo»~.»_y v,.~..w \and read for the construction of
one Bridge and one Concrete Arch
Culvert and incidental work on the
Florence-Blair Project No.91-C.
Federal Aid Road.
The approximate quantities are:
Station 97
a-so' SPBIL4 Deck Girder Bridge
Station 176 and 6512'x11'9" Concrete Arch Culvert
Plans and specifications for thg
work mav he seen and inform-
I-'uurtcen (14), Township Seven-
teen (17), Range Twelve (12),
nmning thence Wen Four Hum
»dred forty (440)feet;thence
South Two hundred ninety-seven
(297)feet;thenm East I-'our
hundred forty_(440)feet to
center of uid rand; thence North
Two hundred ninety-seven (297)
(eel to place of beginning con-
taining Three (8) acres more or
lean, all in Wuhington County,Ne bna h."
Said sale will be mnde to satisfy
dea n ma de hy uid Co urt an
Cho 14th day of April,1980 i nhvor ol uid plnintilf for the sum
d $8253.91 together with wats of
Ini t nmnnnfinv fn grass nnrl
s
ation securqd at the office of the
County Clerk at Blair, Nebraska
or at the office of the Department
of Public Works at Lincoln, Neb-
ruska.
The successful bidder will be re-
quired .to furnish bond in an
amount lgual to 1W% of his con-
trad.`
As an evidence of good faith in
submitting 1 proposal for this
work,the bidder must Gln,with
his proposal,a certified check
made payable to the Demmant
of Public Works and in an ,amount
not, lean than two thousand (20W)
dollan.Thk work must be started pre-
|
'E'ng ¢IKI°»|f»§`f»§v:E§h said order ol sale and decree.
D l h d at Muir, Ne bna h, this
HM: day of January, 1981.I.-6t llui o n s uprlma , She ri !!
ot Wlshlngfon County, Nebnaka.
vioun to March 15, 1931 and bo
cemplebed by July 15, 1981.The right is resqved tn waive
All Uechnlwities and Rject any or
All bidi.
DEPARTMENT QF PUBLIC
WORKS
'c b 'A R S ! G £ é £6 5 1 2 "; , } ; " C {. , ' u ; ' g § 6 l r k \
9
The Board of Cmmty Commis-
sions!ol Washington County,
:mn -.¢ u,w n| » n¢ b¢ x e u» a .y °1Phhnmry, 1931, let. tn the Iowan
l a d hidntr | yearly eonttut
(o r wnstmctlon md a re da n
o r nntion of All bridges,bmd appmadrea thereto,
wit o i which s hall exose\'l $500(aeepting cement nnxctmea)in-Qkldinx substructure:and ap-
p u u g m,superlrtnmmea,mater-
ial, labar, md full completion of
suns Mdy fo r use ,to be bdlt
by Washington County during the
8-8t Washington County.
THE HALLER COMPANY
ANNUAL STA'l'EMEN'|`
ASSETS
Cab and Nom Rec-_--3 1726.40Accts. Recdvxble 10831.98
Invsnbory---.._---_--_- 18106.49
Plant soso.oo
LIABILITIES
/mm and Notes .
Payable -----..-$ 8838.18
ss<rr1»1.B1\
'Surplus -.....-------__-- 14816.69?f."'°!'.."l"3 f? '¥ff!-}!".!.*3 .' '°| c=» im su>¢\=._...-12000.00
u m .Lau u a ]v x all-|.||.|.lry,1 8 5 5 .sua bm.; mu be .UL marred]m m m :.87mm p e r l i n e d f o o t f o r a u p e n tm oI H; a g p u 'C.M. Hitc h ma m,Vic e-Pres.
f m f d l m m m m m f lt l . M J n f l F u n e u ~ n o v :
pe 1 r 7 . ; . , 5 ; . , ; V
in mhaiructuxe and appmadxes; u.
\ qza i fi e d :um per loot (board
mngmg) for all napa, away braces
mndo li le rv o o dmlte ri a llv s e di u
mubs u-uetumuud;ppmuhea ;ntn
aspedfied mmpe rc u bi c fo o ti ndnae !o rd4 mo ,br!¢:k,e emmt,o r
'e mne ha y n xi qntgs p e dne drumrw- li nea l foot fo r tubi ng; lt n
s n x r n u r nz-.unnsnn |.| asCwhfy of Washington |
C. M. Hitclnmn and Grace Hill,
being first duly swam,on oath,
n y t h t they are duly elected,
qudified and acting Vice-president
and S w w r y respectively,and
dnt the nbvve md imzvins. is s
full,h i r and ma nga '!'".2"
- 1qa edfi edsumperpa nndforiron,
|he.\,oro¢!mrmat|.l maberhlnin
phc a Bi ds forreps irs shnllbe
,| za ¢ p e d md mmp¢ r \ zn i t qu m~
Hi fv i nv lwb-Allblds o ndee lnnd
*ma d ntrucfmmtobemmde se p-
~lnw.Bi ds lha lla ho wthe pri m
"wr thousa nd fnrhmli nguzdput-
'i£i|;go\d|umberi11P\l¢¢l*-YIHPWEU
$ 9 thmn ndr e qll rv d i nnp ux-
u u w m e n !o x m e c o u m u o n o r T h e
Hiller Company on the Slat dly
of December 1980. and that they
nuke this verification u Vlce
president md Séc wm respec t-ively ol said corpontitm.
C. M. Hitehmnn, Vice-Pres.
Gnoe Hill, Secretary.&nblcribed in my presence md
sworn w being me this 8rd day >work pm ix; plum of mpentme- of nunm-y, 1981.mn; pry, per thousand in muz-Hy Oqmmis si an Bxpm, Mud
tum; prim per thousand in [ina]18, 1932.foot for piling drivm ln place un|(SEAL)H, | _ Hmm.
rspair work;all bid! fa incluah 8-lt 'Notary Pqb1|¢
NEWS
Mr. and Mn. Bd Kelso of Omn-npent Int Sunday in Herman,sts o! Mr. and Mn. P. S. Hop-
md family m d Mr.and Mrs
Babe Ryan, Mr. and Mrs.John
Petersen and family and Geo.
Lune were Tuesday evening visit-
ors at Rudolph Mencke's.
Mr. a nd Mn.Clarence HansennxdtheMisses Edna. and Lenna-Hansen were Wednesday evening
\'ls'ltors at John Petersexfs.
Mrs.-Detle! Wulf and Hazel
called at the Will Wulf home or-
~.~ e ~ o ~ f ~ l i n ~ t ~the dune at the °1;;f- house manm midni ht Mrs.ul! served \delid Tm. to the guestsu=f'"L.d Mrs.Mull Go nha m
and children vddicd Sunday aft-
ernoon at the Harry Madsen home.Mr. ma Hrs. Dade! Wulf andHue] were Sunday visitors at theSoren Jennn home.
Hr. and Mrs. Will Rygn and
I
ROSE mu. ITEMS
About (Sit relldves md friends
helped Wulf mlebrate her
,~¢||..d Mi sa Gra c e Tomlin so n of ' Pe -
ma h , s p e n t Mo n d a y a t th e F r e d
~gen home.A i t e r v i s i t i n g r e l a t i v e s h e r e t h e
t m e a d a y s , h i r . a n d M r s . . F r a n ;
l |. | ~ .1 ~0
hz: manhga.The demand was
hom Jun. 14, 1900 mr) ,,.,,¢ lwly
Jan. %,1931, at the Gul Timm
home at Bennington.The deceas~d is mrvivod by her husbmdand
smdl mn, Leomrd,five sisters
ol0m » hn,\v ¢nS\nldlyg\n|ha t
the E. W.Joe Andanen vu here lunweelufrom Powell, Wy°~ fm' | vidt withrelntiveaand friends.He ny sthe y nll o Mn ha d 1 mi ld y um
our then.
m n m m li l -dv rmv. will :pak an '-Phil~
Ezines" at n mating at the Bw-
church Monday evening, Feb.Het wo rk ll in thue his llndn9.She ig home on a lurloun meet
There will be no ngu
rL|:AsANr wnw mm
HAMPSHIRES
s-A»L-E
LQPIA1' :Work to at-\.rt soon on
viuluct ut mm. place.
Elm Creek-Ted Jntuuon and
Chula :Phelps eshblished Ward-
mbe Cleaners md Clothlers in Ray
hmlding.
Kenmnw-Natural Gm Distrib-
uting Co. installed nnbnzll gms in
Dorothy pendeld nnrtdn-ed Marian i i i . -Clu-Koa Ryan
lm! Dorothy Petenen at A dum-ber w at her home 'hmsdny
evedng honor of her birthday.
Elm Ka y.Funenl services were
held Saturday at three o'clock
from the Presbyterian chnmh.In-
lxennent was made in the Ft. Cud-
boun cemetery.
the Will lvenon home Thursday
evening to help Chris eelebx-an hh
birthday.The evening vu cpm!phying pinodle.ln . F itd lid le
md Cul Rohwer held high scores
while hun Rathnnn md Henry
Fischer were consoled.A most stnlled in vicinity nonhunf. af thll
plwe by Lincoln Telephnnc 5:
Telbgraph Co.
Pl|m.smcv;xL'1-Louis L¢.hr..>-'andCluurles Ault acquired pool hall on
mouth dde o! Main Street fnrmcr-
ly owned and openxbed by A.M.
Arriva."
tered pheu in this vlll-ws.Cnixhwn-Interxuk Power Co.
received contract to immll electric
lights in alleys nt' hudnesa sectiun.
Mayox-=-Mrs..Ja n ~.n~nweld Sundly dinner guests of Mr.
and Mrs. Joe Lnzurc.WUI lnrlo ns spent Saturday
evening at the Henry Fischer
home.
Mr. and Mrs. C. B. Mehrens and
Henry Rnhwer md Anita Mehrens
matured to Lincoln Sunday intake
Miss Anita back fa the University.
They also visited at the Chris
Rahwer home in lincoln.
The basketball games betweenthe local town and high school
teams and those ot Banington
At~tha ~ g l ~-~ n ( ~ y )evening, given by a committee 'nfl
four members for the membup of
the Legian.
Surlday dimer guests at the J.A. Wen home were Mr. And Mrs.Kyle Jansen and dn|.§hter ofGrmd Islmd, Mr. and rs. Rob-ert Adams md children of Teh-
mah md Mr.and Mrs. Everett
Welt.The high lchool cnrdixmln wait
to Blair Friday evening for 1 gamewith the lslnlr tum.'I11e remitwu a 24 la 14 victory.Thesame
:IAND VICINITY
The Coiliee Club mel. with Mrs.
Marie Mehrenn on FHday.Tha
afternoon was spat playing pin-
ochle.M n .Hugh Vaughan won
first prim and Mrs. Minnie Kruse,
booby.M n .Emma Hanna and
Helen Kruse wen viidwn.A d
liciou: lunclnon was served and ndelightlul um was had by ul,
Mrs.Fred Moeller enterullned
evenin~the Blair town team wuneight ladies at pinochle Wednes-
Mr. and Mn. Arthur Schneider
motored to Rosalie, Neb. Saturday
to lP¢nd the weekend with mela-
tives.
~. nnd~idn ~T~ J~ ~ npdl.Clunnce Sale-Silk Dresses-Bobbie were enhrtained nt dm-'Values w $20 gn lt $7.95 and
ner Saturda y a t 'J w D- 1-1 BlY".Vslue| m no 2° M. $5-:is a u
h .'|°$v. C. C. Norlln md the Boy lw 48.F Cenfaer.3 -ll
Frelda and Hmry Steffen matured
to Craig, Neb. Sunday to spend the
day at the Wm. Webster home.
January 27 wu the 89th birth-dly ol Mn. Fritz Steffen, who re~
sides with het daughter,Mrs.
Chas. Moeller.On that day two of
her dnughters, Mrs. Emma Koich-
mark and Mrs. Anna Wmlnt, andEmma HI-una were dinner guests
at the Chu. Moeller home.
Mr. Darcy Hughes is carrying a
verely injured hand in u sling
~ '2ié`p""`E£1§ Wwnen-day
morning 1or their home at Wmen,
South Dakota.
The new officers of the 0. E. S.
met Wednesday evening at the
hall for practice.After they werethrough,Mrs.ummhard,worthy
matron,served doughnuts ann
coffee.Mr.and Mrs.M.Madsen and
Walter,airs. John Andersen andMrs.H.P.Christensen of Blair,
were guests Friday at the Chris
li o rs h o j h ome .Ev..' I n r ln r F w n r h s:l|=*t\L \\€
ne
of
nl
az
....~.lxennent 'was made an the Ft. Cud-boun cemetery.
Mr. and Mm Fred Moeller md
Freida and Hmry Steffen matured
m Craig, Neb. Sunday to spend the
day at the Wm. Webster home.
dxy ol Mn. Fritz Steffen, who re~
sides with het daughter,Mrs.
Chas. Moeller.On that day two of
her dnughters, Mrs. Emma Koich-
mark and Mrs. Anna Wmint, andEmma HI-una were dinner guests
at the Chu. Moeller home.
Mr. Darcy Hughes is carrying a
severely injured hand in u slingthese days.Mr. Hughes and his
neighbors were blowing stumps
and une fuse had failed to go ull.
Just as he tauched it again the
explosion occurred, splinteringone
finger quite badly.
Miss Frances Lund dnd Cecil
Patrick, both o! Craig, Neb. were
united in marriage Jan. 31.Mrs.
Patrick is the daughter of Chris
Lund, formerly of this Mace.
rumsm wnw mm
HIRESs-A»L-E
55 HEAD All Immuned HEAD 55
To be held at the htm 4 miles Nnrthennl of Missouri
Valley. 5 miles Southvyest ol Logm,Iowa.Sale to be
held in sale barn at the (km.
MUNDAY, FEBRUARY Q, 193]
BR ED s ows and G mr s
Bred to the three Great Bars-Nebruka Whirlwind
lst, Desgnefn Flash and Dvllnr Chmge..
Offering lncludes many of our 1980 Shaw Winners
This is A fine lat of Gllts and Sow;Come early and
inspect the offering.
We Also sell 8 young purebred Holstein Bulls.
Send for catalogue immediately.
.FREE LUNCH AT ll:30 SALE AT l 0'CLOCK SHARP
TE R M S : Ca s h f
(COL.M. H. CRUISE <9 TOM Hsfvosmov,Audfonee
B. /. WOOD,Clerk
A. A. Ar o nson i f So n
OW NE RS
,J
~nn
s I J o H N s o N
Aucrnom-:lm
Blair,Nebraska
SEE US FOR BOOKINGS
._,|1 ;I : ~al $ 1- -s iz es 1 4 to 4 6- y o u wi ll s ay I o! n ea r Sp ik er , we re S atur da y e ve -
th e y a r e a r e al b a rg a i n wh e n y o u ai n g vi s ito r s a t th e La r a P e ter s e n
see them.Fashi on Ce nter.3 - lt orné.
W i nter Coa ts f W __1_1 Mr .an d Mr s .De tle f W u l fo r ome n va H 1 d J .T h m d vues ~ $35 go at $10.75 and $16.75.eJ I§§ng""vm€ ° " § " Z' t° " i 1 ¢~
Fas lno n C enter._3 - l t ,Ruhr home.
- - - » - - - - n r l u 1 \ » ~ n vi
Fum Sala 1 Specialty.Phone--Wlzite 263
ernoon at the Harry Madsen home.Mr. ma Hrs. Dade! Wulf andHue] were Sunday visitors at theSoren Jennn homenn. ma nm. wsu nygm and
r es Ault acquired pool hall onhmlding.mouth dde o! Main Street fnrmcr-
Kencmw-Naturd Gm Distrlb-ly owqcd and openxbed by A.M.
ating Co. installed nnbnzll gms in Arriva."
md family and Mr.and Mrs
Babe Ryan, Mr. and Mrs.John
Petersen and family and Geo.
Lune were Tuesday evening visit-
ors at Rudolph Mencke's.
Mr. a nd Mn.Clarence HansennxdtheMisses Edna. and LeoneHansen were Wednesday evening
\'ls'ltors at John Petersexfs.
Mrs.-Detle! Wulf and Hazel
called at the Will Wulf home on
Thursday afternoon to see thencw
baby.
Mr.and M m Joe Jessen and
Iamily were Tuesday evening vis-ibon at the Will Hansen home.Mr. and Mrs. John Petersen andfamilyandGeorgeLusewereSunday visitors at the Wlll Ryan
home.Mr. and Mn. Walter Applebx
and Betty were Sunday dinnel
guests at the Watson Hain horn:-nenr Herman.
; ; : : i ; ; : : ; ' ~i<?%T=@f¢»»=1|¥;§;":s;if".;;;'.; ¢;"°.,,.,;'5¢'1;:a;",;;f ?n;0n.s w;,,. siiven-s'Pl8>~d on Thursday evening, werei
Tekamah, spent the past week 16.A number from here attended. 11;-1¢1 high scorn and Mrs. .Nelglwell attended.The acorfes for the.
the hom;oiher parents, Mr.Mrs.Hm g g Bwwftffh -ng Hansen, Iow.suitable prizes werelhigh school teams Bennzngbgm 23-=
ul Mrs. C .ris amen.Jeanine of r.spent e P" 'awarded each.A dielicious lunch Calhoun,s-for the town ams,=The beneflt darwe Thugsday ¢\"f2f week h¢IB It U18 J. M. Brewstelufsm nnnmd hv fha Imnfsne and n!C8lholl!| 34: Bennimrton, 8.|
nin netted $12.00 for the urougm home.lrvnvuu Iv;nun 6-3 ..pfeasant afternoon was spent by Mr. and Mrs. Detlef Kruse mo.'ln D ns orchestra M . A. L. S Ili 11 b h t .~ tho ?,..,,.;§"one 'ii tho nn»H§;f;;i@nem?~:l@H1\»!°"°d.'%P *P S1o.ux QF" '§'?""°'.
':€'.""'?{
1
"i3f"§f11§§F=sT»f§I£éd SL the home
of his daugnter, Mrs. Bmce Smithand family in Omaha, Thuredny.Mrs.J.E.Sidner and Mary
.Kathryn of Texaxrmh,enjoyed'Ihumiuy aL the parental, Dr. A.
;§;dBés&§§, ;f1,'. ; ; a . a " " " "
Fred Rogert severed his con-
nection as assistant at the Herman
filling station the first of the
w\;'ek.Miss Ie°l& Cumning5_ of Om;-
Misses Anita Mehrens and MabelNeale, who attend the state uni~
versity,spent the weekend with
home folks.
Carl Rohwer celebrated his birth
aniliversnry on Monday.There.
tovisit their daughter, mrs. mmm
Tietgne, who underwent an opera-
tion in a hospital at that place.She is getting along very nicely|
and has returned to har home at\
this time.1
J.
H
C101T1ni
.un.an d Mr s .w m .ktu u en g e o r Uma n a, e njo y ed S un d a y n e re a q ap e n t a n enjoy a ble even ing,an d
we n t to Omah a § u n d a y t? _ g m h e r t h e _ ~ A . ~ h o m e .: \ : c lw1 ; ] 3 n g Mr .Rn h we r ma n y h a p p y
';x':.: aT.'l.'.,`€\I.I.R§`}.,§§na§f"ldv if ' a n ; ; ' m `ix`E'"""w;¢h- FSF' ""'°.a. o n:runs '"'¢ =;;""|
ur, student! at Wayne Suu 'reach for ¢f=¢*gg° to be given.ian Gnllnrp. smut the week-end!!ll rl .Lnnnn I l Immn.\ . - u v w . \ . ° \ |° r " " '»-. - - -- -~t h e i r h o m e s h e r e .
Mr s .K .J .V a n Va lin ,wh o re-
tu r ne d ho me la st we e k f r om a two
mo n th s s ta y a t the Ni c h o la s S e n n
hos pital, i s imp ro vin g.
L n t l e A n n a M a n e a n d Ros elln
8 g H l . - f l 0 ; l ; l - £ 1 0 " ' " " ' h ° a ; f = , m a
is re c up z ra tin g f r om an o ration.Th e me mbe r s o f th e ste ral
Assoc iation o f wh ic h Re v,No r lln
3 ; a me mb e r , me t a t L y o n s Mo u -
a r .M\\'r
mtndl
-' m i "==;~m"' "';,¢i.i'|idly nz Hr Ind un.
'OW during the chlldlen'| hour. W m. Adlml ~ at dinner*'.£L'°f§..?E:>f\'!=x£°s.*£*:1'°5'r1=°!*: £25 9Ea'£'f_".'?-.§~.{;9FP'°'.'1E~
r e t u ~ s o f th e d a y .
Messrs.He n r y a n d J o h n Ra th -
me n ,Ca r l Ro h we r, J r .a n d L o u i s
W o r k m a n mo tor e d ove r to S'hen~
an do ah , Io wa . Tu es da y to vis it the
rad io broa dc as ting stati ons,K M A
a n d K F N F .
Mr s. W m. Iver so n a nd d a ug hter .
Edna we re h ostess ' to th e ke nsi ng-
to n 'Tuesday af ternoon.A ve r y
delic i ou s lun c he on wa s ser ve d a nd
a ver y goo d ti me wa s ha d b y all.
.|;.|:0
s I J o H N s o N
Aucrnom-:lm
Blair,Nebraska
SEE US FOR BOOKINGS
tained the inemb ers of the Happy
H o u r Club and t heir hus band s at
pinochle o n Wednesday evening,
Priz es were aw arded for fir st and
second high;Mrs.Chris F r a h m
and Henry Fis cher held high and
Mrs. Jacob Sier k an d Sco tt Allen,
scéond.A delicious lunch was
uew ed a nd a mo st e njoy able e v e
ni n g was h a d by a ll..
Ab ou t twen ty g ue sts ga th er ed a t
|||l|||||l|||||II|||I||I||||Il||I||Il||||I|||||IIIIIIIIIlIIIIIlIIIHIllllIIIIIIIIIIIlllllllllllllllllllllllll||||||lI||I|||||l||||Ill|||I|||I||l|IIIIIIIIIIIIIIIIIIIlllIIIIIIIIIIIIIIIIIIIIIUE
I I
_
§I have decided to quit farming and will sell at public §
§auction on the George Boschult farm five and lane-half §
§miles east one mile south of Winslow.One mile north §
E-and one-half mile West Telbasta -E
Fum Sala 1 Specialty.Phone--Wlzite 263
th e h o me o f Mn . G. V , B e a d i e o n
Tues day afternq on.Sixte en la dies
wer e p re sen t.Ea c h b ro u gh t th ei r
o w n wo r k .A *d emon s .lun c h eo n
wa s : e w w b y t h e c o mm i tt e e c o n
Bi i fi f lg o f Mf i G. v. B e ad ! - 2, Mr s .
Ge e s ar mm a n d Mr s . P a \ l K r ug e r .
Mr . a n d Mr s . E m i l Ri x o f Oma -
ha , s pe n t Thu rs d ay wi th th e Mi ss -
e s E mma a n d Mi n n i e Ri x.
Th e C o m Cr op ABSOciation en-
joy ed an o y s te r supper a t the
Er n e st K ru s e ho me S a tu rd a y e ve -
ni ng .Those pre sent were : Messrs.
....||
I a SHARP
TE R M S : Ca s h f
COL. M.H. CRUISE a TOM HENDER gg v,Audloneer'
B. /. Wooo.Clerk
(
I I
Nntter, Hurry Seltz,Wm. Kruse,
George Ohrt,Claus Ohrt,C.BMehxvexu, Jacob Siak, Henry Lor-
enzen and County Agent and Mrs.
BatesThe O..E.S. held its regular
meeting Friday evening.
The community was saddened to
learn of the death of Mrs.Otw
Timm, who was Laura Kay before
OWNERS
F U R I I
S M O o T l l N E S S
'1 ._v »1 »5 W ~:==""...~ 0 ....| ! ~ 3
Snuire Jones of Blair. visibad at lwnrhmr
LI'
p
B(C i tv tn Rlni r" " i !. -- - w - .u v - n g u u v n u u u u u a " " ' " " o "- 1 .- w . . . - . . q , \g a m e F r i d a y e v e n i n g .c o m i n g w e e k .
" Y n \ u |\ | » ¢w h i n n u r h n a n h R P V .R n d M n * I *I
uma's u l u ou: a I l u nreturnedlustweek fro
several weeks with L
sa
31
f l
la
ir
ol1:
a.ch
m
S4
#1w
s
L
A
v
ra
fl
p
fi
tl
ull nuns uuu naluru nuncocli.S li m Bidwe ll h ad hi s le g bro kers
week ag o an d ha d to ha ve i t
eset Wednesday .He i s n e w im~
roving as weli as c an be expec ted.
Mr s . 0 .H. God se y a tten de d th e
Faptist Missi onary Qu ar te rly at
we Olivet Ba ptis t c h ur c h a t Om!! -|
u n s u t t u l l l l l l l
rr.Mi ss E la in e K att sp en t the wee k
en d as a gu e s t o f Mi s a Ru th Ro b -
er ts a t W i n s lo w. Ne b .
Ne ig hb or s o f th e Fr e d Robert-
-=n11$k routed a Pro wler f r o m fh.Pir
ho me o n e e wn a mr la s t wee k .I-Ir
in
~ FEBR SDAY
311910ra t d a I ~l l d .b a r n ./n C i » ' l $Z * l ' § § 1 ,? $ ' m ? n § f °'" '°a n |T h e R o b e r t D a u g h e r t y f a m i l y
This Week's
B~RGAINS
--.~\..,»-~==:
m o r e t h a n |§_IET h e n e w F o r d h a s Sale commencing at 1o=oo o°élo¢k Sharp/S twenty ball and ro ller.bearings
Evmmc!-: of the mg. qunlity hnill inln the new Ford
isthne xtenni venaeo fhalle ndm lla harlnp . Than
anemorethnniwenlyin ell--nnnnnnmlly lnrgenum-
ber.Each bearing is adequate in size and carefully
tclecied for the work il hu to do.
Al some poinls in the Ford claude you will Gnd hall
hearings. Atothaqrollabelringalrenaedregrdlan
of thdrhighaeost.Thed edd ing flc iorisl hep er-
formance of the car.-
The extensive use of ball and rolls baring; in the
new Ford insures smoother operation, elves gasoline,
increua speed and power, given quicka pick-np, de-
crasa noise, and gives grate: relhbility and longs' life
to vital moving perm.
Other outstanding feahlra dm make the new Fond
e value far lhave the price are lhe Tripla shatter-proof
glass windshield, dlem, fully enclosed four-wheel hrnka,
four Hondurille doublaacting hydraulic shock absorb-
ers,duminnm pistons, ehrame lilleon dloy velves,
three-qumu Boating rear ale, Runtime Steel, the ex-
tensive use of Eno steel forging, and nnnmd accuracy
i n m - n n ( ¢ n n » l ¢ -
E=E
=
=
=
===
_
=_E_E. _=
. _. _=. . .= :=....=_=
_ .
One
One
One
One
The following ;
8-HEAD OF HORSES 9
team roan and black geldings 10 years old,
weight 3000 unds
team gray and y mares 12 years, wt. 3050
bay gelding, smooth mouth, wt. 1500
bay mare, 9 years,1550
property to wit:
inch 2-bottom tractor plow; one walking plow;
one walking lister;one Fordson tractor;two
Rmmdnn hnrrnwl:nne 9-fmt Janesville disk:
1 - »Mg _
u i :H
_a n n l
*
a1a n u s_u nH n
a u :
n
a n u s_
s u lH
_1 -
three riding cultivators; one new disk cultiva-
tor; one Janesville corn planter, 120 rods wire;
one new hand sheller; one new International 3
horse gas en ' e; one 1 horse Rock Island gas
engine; one ` g mi ; one new McCormick-
Deering manuze spreader; one power jack; one
new John Deere grain elevator,32-ft.,8-ft.
spout; one 14-foot broadcast seeder with grass
attachment; one new McCormick-Deering end-
gate seeder, with grass attachment; one Bird-
sell clover hullerg one bob sled;one Cow Boy
self si ° g tank heater, new;two galvanized
water , 8-ft. and 4-ft.; one pump jack; two
new gallon hog watemrs; one Primrose Mc-
Cormic Deering separator;one grindstone;
one h coad brooder stove with hover, 1000-
chick;n galvanized chicken coops; one incu-
bator; one ay fork rope; 3% heavy work har-
ness; two rolls 50-foot corn cribbing; fifteen red
top steel posts;eighty wood posts;480 rods
barb wire; three steel oil barrels; one 22-foot
ladder;one 30~ga1lon soap kettle with stand;
one feed bunk;some hog troughs;one 6-foot
cross-cut saw and other tools; one ice box; some
LINGERIEAfinebunch oi iingerie in-
cluding bloomers, skirts, step-
ins and vests.
One team bay mares, 3 and 4 years, Wt. 3200.Q i n
l i n -_ l l at n -n
l l u l nnl n l u n_m a n nHa l u m
n u n s1h a s_
*u r
_t h a ni n nH - I n
l a i nHnl !-H
M_l u - nH
1 | - u n_h u a n2
1
"
In u n -n
I l l #
.
I - I nn
n*
nIM
E='-"§§=nE
14-HEAD OF. CATTLE 14Six g00d-I §5 0 ~
Fi '2-year- ld hdQ::.,°:,;°.,":,m..:sd Rea ;':.M bunYour choice Ck each
H()SIER Y Two cdvcas
nn v m n x n w ' l l f \ { ! § _ A | \Twéllty-fi;;5ll'I'(;(;l5;l";;y `\§E'<»`<§d s<$§vs
Fifteen stock hogs _One Duroc Jersey boar./"
"Ruby Ring" Hosiery-always
the best 'T he m ost comp-
limented hose in America'
$1.00 - $1.25 . $1.50 HAY AND Gm~ bu§hgls ear com in cribRa yo n Hosiery, regular 60c
200}nishels oats
8 tons prairie hay
6 Dons alfalfa hay
Some hay in bam.
M,
value " ° u °=
=
Special 3 pairs for $1.00
COA TS Acnmnnv==' i i. _=: =_==E_E
=
. _
- _
One hay stacker; one Dane hay sweep; one 6-ft.
Deering mower; one Osborn hay rake; one new
McCormick»Deering 8-ft. binder; two good lum-
ber wagons; one wide tire wagon and ay rack;
one gang plow; one Moline sulky plow; one 14-
USUAL
FREE LUNCH AT N
A f e w Ghi1dren's Coats left
SPRING DRESSES
See our newline of Childrerfs
wash dresses from 2 to 14 yrs.
and mahousehold goods
numerous to then'
TERMS
IOON
.ny other articles too
:.-._
your own cup
tion.
Good prints. guaranteed hat.511118colors - New styles
#435 to $660 ~c m .E r m m g v 0 w n e r ~
0 /'9 §
|n R A D L E Y & s E A n 1 N G , A u c t i o n e e r s w f m s n o w S T A T E B A N K , C l e r k .g s
.\F-"1 \~~ w ~w ~~w E
The l ' . 0 . l ~ h l l r d | , p 1 u f N l d l u n - l l a l a l o a r y .l i u l l l p u n u l u p n i é l
n n u a l u u n l l n n .f ¢ q ¢ | » l » q p a f o r u l } o r ¢ a l n l l & | u | | | \ ~ | h i l ll l a : o n l l l n l n n l j n n u a h s g p l c n .| | | | U 3 u u r | ' a r l l | | J l l } | l ' l |STYLE SlloPPE
@i n - _ - u n - :u
~ »;.:§..4..:»¢.§ixJav "'" ~ f ~.;.1,.; ,nu L Q ; =..i»:n ;L>;f;.»:,». rfli/Q..A~,aI».ai Zhl. 'e£<».:,\;_¢g;.1 ~I un -u-\l-.'&'Q»»} |».r.§.,¢.4
o n A . \ n a o A D&n u n s :
sz E T E R P R I S E
xssuxn EVERY 'rmmsnn
Thursda ifmmoon to attend theannual &v.M Wagon area coun-
cil of Boy Sco~ts.This council in
:":~1I f l l f
R U P T U
ection ol officers was held andve
LWE STIIEK Pam 9 nv
~_ _ _ . ... .. ..
AS 'noun BY THEIR PASTORS
| ~|I-»' ~L l l l s ~
n m ~T E R P R I S E
mm ( A.\naoAD&n u n s :LWE SIUEM SHUT
Fat Cqttle 25-
Week - T
Moss new
n c u m m B r u k
a t 88.0008-503
u n :s t $ 1
m n d d ~
-~: \ : : |
\\:m.ma` u mm-an x
the meT . ,uw An at conekvu <5
Much 8» 1878.
- :r1|r :-1": \ : : 1 .
Prioeperhar `s w \M....e..~.................»...--~-.-his uneqwled method in Fremont
TUESDAY, FEBRUARY 11
at the Terry Hotel from 10 A. M.
so | P. M.llr. C. F. R.ed.lichseya:
'nm "Perlbet Retention Shields"
hold the rupture perleetly,no
mat!/er what position the body ax-
aumes or how heavy n ght you
lift.They glve instant relief and
contract the opening ln a renm!k~
ably short time.
......,..e».Mr.md M n .W.A.Whitfonl
went to lincoln Monday and Mrs.Whltford will remain a few days
for medical treatment.
Mr. and Mrs. Raymond Ludwlg
mteruined nt a most enjoyableallllr recently when they requen~
ed their guest: to come nttlred in
hard time costumes.The result
wan some very unique o udi u
which caused a lot of fun.Atbridge the prize: wero won by Dr.L.M. Peterson and Mrs.Leo
l FIRST n m r n o n l s r c n m z c n
w. Byron Pardon, Pastor!Lut Sunday was an unusually
The Treasurer cannot pay the
church's bills, unless lm members
provide the funds.
The expenses are the same when
good dey with ua.The mornlngyou are zltent as y/hen vw are
service espedally was unusuallywellattended.'TI you are na il
planning to attend services else-where next Sunday, you will find
1 cordial welcome with us.Ourhoursare:Sunday School at 10
[resent \ '
CONGREGATIONAL cé mzcn
A.F.Newell.Pastor
Llncoln'a blrihdayveill be n Li:nzomlng Preaching services at uf f-A soma" mm-».h.¢Mn.a..7¢\..§
,ff
Oc Lower forvo $10.25
.ow |1svELl
s e e m . s u m
m a n -u m u -u o u s s Me d
m .
...~u,..=...,......... ... -.-, . . _ _ ,tried md true, \Zad\zlts. Harem:
two recipes for eae cold weather
delicuden tlut you will with xp try:
Cri mp Mo lno s Cuki u _2% wp: speeisl cake Hour, nth
ed; 1 hnspoon baking powder;1
teaspoon lllt; 2 taapoonl ginger;1 M.. ...n|....|»IA mn bud;-.r ar
pn with 1 cup of mnpxe syrupI M ;1%cups of water and 2 tabl
spoons of butter.Bake until the
syrup is thick md serve with
whipped cream.lheuvml Sllul with Green Pegpgr
To mah macaroni wad, toss m-
...n-- |:..».»|.. mm nm. .1 umlmd
E va r y subaarlintion iu nsgarded
nn n lmn n n mr li t. .T h !I I I D I H U
ra » .nb.a .m xxncnstletux-the
my an ma xnsouu m m m
n m e n hem
lunninh l n n
`f£$"',i2=}¢': E ~gittrflour ones, measure, ndd bak-
ing po wder, :dt and gmga, md
silt again.Hut molasses, :ummfromfire;add -»»»»f=f»»,_§,_-gf soda
Add n :ull Ro..».'¥2'.,. .nfnuf nnumd baud.
'"""'"" 'f*"""'¢ """ "`°"" "` "`"""""The secret of their suwesa is in_ ? _ ;'f'f"'°°f;°;p1;§'_"f'§nenwf',]|m¢ir simplicity.An ixpamy nd-
onion nd an apple, an chopped, justed device s e opening
Leg d in an wo! pllltia untilwell withoqt discomfort or detention
|fnm wo rk.It is practically ever-chilled.Serve with mayonndae...il'Iare'» Slmnlo Plan m 'f*1t=F§*§ff .,_;5i€°!<3Ff2':°°, fi*
Weber,
A. A. 1
nnged
PetemmYaldahA. A. EWeber,
Wxsley Ylldah axIxhlbeck.Places wfor Dr. and Hrs.
n,Mt. and Mrs.
of I-'remunt, Mr. al
Ilhlbeck, Mr.and M
id Mr s .E_pworth Le a gu e nt 6:30 and ewfe-
ere an-r u n g pre ac h ing servic es a t 7:30
L .M .o'c loc k.Go od music .
W es ley " C vme th o u wi th u n a n d we wi ll
ad Lira.do thee £0011
Irs.. Lea
§Iini'{Z§§'a&}iI-é§é"§5d'i§1"i11§»7£11`iii
dren's story -period.F l a will bedisplay ed,an d a patdo li zs sp i ri t
wi ll p mf a i i .
Te n o c lo c k a n d n o t 10 :l.» la th e
¥...... J...vs...rm........1. n..1.....\1|~......1.
E"'1»§ T¢`T$"""Umm g #--Ovminz D....... .?.°.\l';......\ nm am; .mn wack um new
dun;|mmadeaputo!;h;eun-some °"°' aw:um.um publisher ma ._§f1'*g{;_§°imzia
Lipcoln,
er II -vfim,
BAPN:-rr cnv a ca
L . J . Ma nn. Pa m
Sunday was 1 good day in our
church and our hearts are glad.
Seventy-seven in Sunday school.
Twenty ln th .leunior B. Y. P. U.M.-.:.... ....| -..-..x..,.. :,...,:..... \...n.
..v... .ul un ul-um wn wl .l u m -ers and aftlsen ghquld be on handby liv minulea before that hour.und ¢ e,School should beginprompat ten.Th young ameople meet at 6:30fo r t lr Sun ay night lunch qnd.dlsc\'nn hour.
..But :bln it not d¢ad:l\ellvea
Mr .and M n .
G FL Min ka nfmbuzrlber.
n ¢
o
o
»
n
y»
¢
¢
a
a
»
o g u s n a u a n a o a o u
Ng3RASKA»3 EASANTS
As a Nehru n, we ¢an't
help but "Q a§rry for Sin-
clair Icvris Who recentlywon the Nobel prize offered
by the Stockholm Academy.
His speech vu probably anaccident md we doubt if he
will be heard of again.At
any rnte he diaplayud his
s
a
s
o
o
s
_s
»
¢
»
»
»
1'1JS`61'11,66J"''ma i x;" 5
ment llv llilh mam -wg; nninh.
Both c an md a n ~;;;,°°° i a e dm md m thu nm-
QIIDIINDD on asm: Choice w
prima yesrllnn 011.50 6 ISM:good so choice narllnn 010.00011350; mr no soon 1-gw sub
_B 315;warm uv;s.ow1.oo: choice B0 prima ma
mm 811.256 1215:cannon to
mr yearllnzi $'l.0005.25; eholneprima heavy men $l0.15011.'I5:
zood. choice handy stpen $9750
W.,-- ........_, -.-..___Cut with floured eooky emma.
Bake m mdnate ov en (850 ae-greea F.)10 mimics.Mahal 356
dozen ewkies.Sdpr Cookies2% cups spedll nh Hour, lift-
ed; 2 teuponns baldng powder; Kwalpoon nutmeg; x,§¢up butter orother shortening;1 cup sugar; 2m b , m l l beaten; grated rind 1lemoh;1 tablespoon cream.Silt
flour once.meuure,add 51518powder and nutmeg, bnd dit tn-gether twice.Ore.lm butter thor-oughly, add _sugar ggdggx{ly, um]
1 l h k e L e m o n ~a c m l u y n m u s r u p t u r e ! w m c n n e r : -o A d m p l a I c i n g , " , < | t w o c u p s u o z e w e r e c o q d d e r e d u n c o n t r o l l -
|e .d p a v n k x e d l s u g a r ' g i t h r e h b l ; - |S t b n m c h t r o u b l e s ,b l r k a c h e a n d
o l e m o n c e b r s u -~\ n . . | . . . 4 i n m n l z n i t i . . . : .I e o n n l p a d o n ,n e a r l y a l w a y s a c o n q
Weber.Mrs.
spent tl
ents,M
lord.
nE "`1¢ ""`§}ifi{1i
Er. and Mn.W.A.
`s"`i2l\¢I sis."
Shelled nn; meats are no more
=¢=<P¢Dliv° than the unshelled wh,eniyw consider thu lnbor of shelling.
Ule la m Sa uc e fo r
.Qhldqg Plllln lldding\._
sequence of rupture, promptly dis-
appear.Bring your children.According
to statlstica 95%recover by our
method.
No1'|cE=An wham we have¢¢ »| .¢ hu l ,a . . . .: . . -A . -
A number of tr-lends and rela-tives of Mrs, J. C. Blnckbnrn wl-
ed at her home on Wednesday eve~
ning to extend eung-ratulntlozm on
her 85th birthday.Despite hermnny y e w.Mrs.Blackburn at-tends m her dally househqld tasks
s l l v l l u u b S u u ¥ ; v ¢ l l u l §l r c s v l u c n u v u lw e l l a t t e n d e d .A t " c l o s e o f t h e § e ", 3 t h £ i B g t ° : n ; " : h e i §g v ` ; » f e ,g '
e v e n i n g s e r v i c e M r s .E u l D i n e T h a t m a k e s A m e r i c a a s p i r e .~.
C u t t e r a n d s o n s ,L a w r e n c e a n d
Russell were baptized.We had a Qven npw, as whgrg in l{fehe led.
Mix together 59 :np of sugar!with 1 tablespoon of coma¢arch,|
(pw orni nu nf nn And
"""'1 '"',""'""" ""' "T" "" '°"'° a nd e njo ys li fe tn i ts fulles t e x-number of visitors in the evening-He leads U! onwnid from the deadare xmlted to come m for a free tent.Refreshments were served, We welcome you.Come again.'Yes, over the whole wide world he
inspechon.which included A birthday cake Fifteen of our women attended bends
HOME OFFICE which her daughter.Mrs. Davies the Missionary Quarterly held at To make the world a world of
535 Boston Block,Minneapolis, baked in honor of the event.muh, 'a n Fri da y This was uid friends!"-~Markham.mm .Mrs,v . v .Marshall and Mrs. .__ ...,._ .._-.'.,__ .,..,_,|
c~rm together until light and
fluffy.Add $888. lemon rind, and
cream, and beat well.Add flour.
a small amount at a time.Best
after eaeh addition until smooth.
Roll into thin sheet on slightly
floured b0B!d-Cut with floured
cooky cutter and dredge with
sugar.Bake in hot oven (425 de
gnees F.) about 7 minutes.Makes
2% dozen cookies.Delicious Honey Date Cookies
Three eggs, well beaten; 1 tea-
spoon vanilla, 1 cup of honey, 1
cup of chopped nuts, 1%cups of
flour, 1 pound of chopped dates, 1
teaspoon baking powder.Mix
honey and well beaten eggs to~
gether,add baking powder and
flour sifted together.Then chop-
ped nuts and dates.Bake i n a
long flat tin.Mixture should be
E6 inch high in pan and 'A inch
after baking.Cut in strips %
inch vs-ide and 3 inches long and
roll in powdered sugar. Pack away
in crock.OTHER GOOD RECIPES
Apples in Maple Syrup
closing rebuttal speech of Alice
Becklrnan which turned the iide in
0
constantly and let boil for five
minutes.Remove from the fire
m d mdd 1% feaspmms ol lemon
juice and 1 tablespoon of butter.
A little nutmeg makes a niceaddi~
tion.
Use VH! Slow I-'ire in
Fixing Caiamel Sauce
To make caramel saixce melt 2cupsofgranulatedsligarina
sauce pan, using a wry low fire
and stirring sonxtmtly.When
golden brown, add 5 cups ol rap-
idly boillng water.Cook for three
more minutes.. The trick is to let
the sugar melt and brown lightly
without burning.
Sxndwirh Au Gratin
Sandwiches an gratin are the
most de luxe hot sandwiches cre-
ated to date.Sliced chicken on
toad: always was the best sand~
wich made, but with u rich white
sauce cver it, baked in the oven
with a spinldlng of cheese on tap,
it almost steps out of the sand-
wich class.
a critic judgment of the. debhte
which was appreciated very much
by both Lyons and Blair.
decidon of the judges was 2 to 1
in favor of Blair.The judges were
from Dana College and were de-
baters of several years experience.
The judges were as follows:
Levi Larsen,Ervin Hondo and
Fredrick Christbffersen.
ln the evening debate,Flair
changed over ui the negative and
Lyons assumed the nffirmative.
The Blair dehatera were Fredricka
Matthlesen,Reed 0'Hanlon and
Alice Beckman.The Lyons debat-
ers were Helen McMonies, Gladys
Loomis and Louise Hain.
I
lIn this debate the Lyons debat-
ers excelled in delivery and team
work.However, the Bldr debat-
ers excelled in organization of
material and subject matter.TheBlairdebatersbasedtheirargu-I
ments an facts of the present day;
while the Lyons debatera had the
oretlcal argument, which was hu-
Nofncs To CREDITORSDFESTATE
.\COUNTY COURT, WASHINGTONCOUNTY, NEBRASKAEstateof John W. Hillmnnfdof'
ceased.
Notice is given to the creditors
to nppear before me at the Count ~Court Room ixi Blair, Nebrahu. é
the 27th day of February,1931;and on the 28th day ol May, 19ar
for the purpose of examination;
adjustment and allowance o f
clai m;All claims not filed on orbefore the zam dey of May, 19st,
will he forever barred._
Dated this 5th day of Febnxary.
1ss1_
(SEAL)L c. Bller. ,
3-4t County Judge
Telmmnh G. B. Steward estrsl
lished hardware store in this city.
l l
».
¢¢
»
»-
».»
ig no ra nc e wh en h e re ;e n' eu
w "The Nebraska Pensz nts".
The San Francisco Chron-
id e very aptly senses the
situation in the following:
" W a i t un ti l th e te xt o f
Sln cldr Lewis'Stockholm
speech soaks into ou : mi dd le
we s t!W hee!I n ac c epting
m s Nnh pl " m p Le wi s w l d
»
_¢»
»»
»
~»
io ns : g o od to c h oi c e he a vy me n
;n.'l501o.1s:I s h ' w m a m e r a
$'1.'lS69.50; eommon ua fair s t e m
$6.00@'l.50; good vp choice swck»
e r s S a z w a s o z m r zoo ds toc k-
c n s125@s.zs;o n to ( n k
stockers $s.z5® 1.2s:tn sh y gr ad e:$5.50@6.00; good ¢o(¢ho1cc feeders
s1.'1s@a.1s:m r mo good m a m
$'l.'l5| i8.'15; c ommon to hir feed-
..JolTn Heiwax¢§e n el \ne<i a t a
..br i dg e di nn er Mo n a y e ve n g a t\ \ o me n s a n d Mis ses S h o e s -th e fo rmer 'a ho me .Swe e t peas
ynlue.:to $ 6 g o at $2 .9 8.F»=sh~an d haby 's b r e a th ma d e " T a w n y
xo n C en wr .3 - l t mnb nmlo c e f or th e fa bh -~e nn-
u u u e u w D m: mc e u n g o x l u K mueve r h eld .D i d y o u e ve r a tte n d a
pr a y e r me e ti n g ?T r y i t onc e.
W ednesday , 8:00._
O n Tue sda y .Fe b.10.Mi s s
C H R I S T I A N C H U R C H
A . J . H m m m , P u w r
Bi b le S c h o o l, 1 0 A. ll.
Mo mk u z W n n h i n . 1 1 A . M
:x MSmart naw ndnnm Miha in sin. |.'.:.'i.;;;:;;;: IS.-i['il|'_l§{]§inI¢f lllurme Cmldeiliurr. I. lllnlinnnrvI chnhifn t~':I¢i§§.'é»L§' §f§n"i_._ -- - - .- -- - - - -- -w u p . . .- ¢ ¢ ¢ »Dresses priced at $6.75 and $12.76
-sizes 11 to 52 and 14% to 2655.
Fashion Center.3-It
Silk Stockings that Wear-Gold
Stripe $1.50 and$1.95; Onyx 3135;
full fashioned silk to top service
or chiffon wei ht We Neverdarng;2 pair $1.Fashion Center.3-1;
Wool and Velvet Berete, values
""'i'i{é """" "Eli i léé " E"-Bld anenjoyablepartyi n £Methodist
church on Tuesday evening withabout 20 young folks present.A
program of games was ananged
by Mary Miller and a lunch served
afterwards.The Iesirue pledged
to raise a sum of $500 as theirshare on the new church and havemadeplanstocollectpennies
rro}fL"£11é"15Hiiii;B}="é' f»1§{§§,"5zi1 ¢nll
speak at our church.This service'Build-meek meeting'Wednesday.
_will telco the place of the Wed-7:80 p.rn.
nesday evenin rayer service.Attendance: Sunday School, 104;The Intenn gte boys :md girls morning worship,54;Christian
oi' our Church and Sunday School Endeavor, 16; evening service, 114.
will meet at 6:30 Sunday evening Bro. Lyle Stricklett, a minister
to organize an Intermediate B. Y. in the United Brethren church,
p. U.Let all come promptly.'Who lives in South Dakota and
o
c
ss
a
O
»
n
a
u
4
»
»
a
¢
o
»
n
..._.._-_. ,..____the Stockholm academy, with
n magnanimoua gesture al-
most worthy of Bahbit him-self,that there are other
American writers quite equal
to the honor.And he really
named them, and in naming
Willa Cather he alluded to
"her novels cnnccming the
peasants of Nebraska".
Peasants o f Nebraska!
Walt until Nebraska hears
about that.Peasants!We
:hall be interested in the re
turns (mm Grand Island and
Fremont.
Again, Wheel"
o a n c a u a a s u s c c s
a
a
za
s
l
s
a
a
o
\
c
4
a
s
1
o
o
aE'r'r1~:n FARMING FOR NEB.
"Nebraska's basic lndustry is
agriculture",is the opening sen-tence of a new publication of thestate university that explains the
results ol activities of the college
of agriculture.
The booklet goes on to tell howthagrosscashfarmincometor
the state is $475,000,000 annually.
Manufactures are a close second
with over $400,000,000,but agri-
culturrfurnishes 10 per' cent of
the raw products for these.Fo rty
seven.per cent of her populatiun
live on her l%,000 farms,says the
booklet."It is startling," it con-
tinues, "lmt within thememory of
living men the nlue of the soil of
Nebraska was dlscovened.Until
60 or 70 years ago the plains ter~
ers $5/15@'l.u0; awe: cows $5.111ous : sto ck hellcn $5.ooos.su:
swck steer cadva $'1.oo@1o.o0:
mack helfer calves ss.uo@a.oo.
A l o o m n s o r m a o c s
Wlth 21.1.01 Il-sh non here on
Monday vrlccs took a nu-ther d-F09
at 10@20c w the low point of theseason.Tradlns was I-Brie!! at aspreadniss.so@1.4o with a m
ugh: butcher welshts UP w $7.50.
aulme BREAK m mums
Fat lambs sold "5@4Dc lowerthanthe close n! h week on
Monday!market and best led
lambs brought $8.50.Feeder
lamtz also sold lower wlth mlxed
kinds uv to Saas.a m me e vheld steady.
PAT LAMBS: fed l\mb5» Hood
w choice sa.a5@s.sn:led limbs.nur vo Kood $'1,1u@s.a5:native
lambs. good w choice s1.vsos.:5:
ahorn lambs $5~W68.25l cull
mmm s4.ooo1.oo.
ma mma LAMBS:m a m ,Hood m cholcc $'1.1wa.2s: ma-
ers. mr fa me $us@1.'zs,
EWES:Fat.s m w choice
s4.oom.oo: nv.. Ink m :cod :sas
o mo ;me a ns .yearllnn to 4
$4.0005.59;»cul.l and canncrmmec
s1.oooz.oo.
The 80-acre well lmvroved hrmbelonging to Ambrose Urlch, near
Burchard.was sold recently w
Lewis Borden ol Btelnaure.thc
conzdderatiou belnz $125 an acre.
ritory, of_whieh Nebraska la a BLAIR w'g§{§__\;<;1g§5§__
4 '
1
up to $1.50 now on sale at thblgr}qugh to ynaloe_§.half a ."f'fl9:l re ll
Sunday3.1;|'I`hia will take a llttle _over 44000pennies and will nearly clear their
|:l || n I | \¢ ::|
takes real money to meet the fin-tives hqsre,spoke for us
ancial obligations of our church. evemng.
E bod IB E L L C R E E K V A L L E Y °";\;j°§nd gggne " g g
called at August Ke hulf'Mr: and Mrs. Herman Lallmnn nesda .
'r led .a !\Ii:x pldagved HehnrdARLINGTONNOTES
The cottage on the lot owned hy
Mrs.John Nibbe has been torn
down and Mr. and Mrs. Nlbbe plan
un erecting a new bungalow there.'lhe houm was one of the oldest in
town and was built ln 1879. It hasbeen in the Reckmeyer family for
nvcr half a century.
Mrs.Ralph Badger and Junior
wont to Lincoln Monday and plnnon being there several weeks,_Mrs.Albert Lallmun is re ortedas improving at a Fremont lirospii-i
nl where she underwent a serious,
onerapon recently.Henry Inc-lbs,who as in the Nicholas Senn atOmaha. is also rennrted ns h»in.1'
|
room mate. Mlss Swaya Petersonof Fremoni, were Sunday guestsat the home of the fum\er's bro-ther. John Hebard.John Hebard lah Mondny forConcordia,Kan. for several days
on business.'Mrs.J. C. Blackburn, who is thu
oldest member in the Ladies Cir-
cle. was the guest of honor at
their regular meetl at the Con-gregational church ednesdsy alt-emoon when Mesdames Men-it!
Cook, P. L. Cady and John I-Iebard
were hostesses.Mrs.Blszkburn
was 85 years old on that day and
the Circle presented her with nnrettv crlft as s reminder of th:
ne.ear, Jr| Wed-J
Sundaydoht,
w eww1Lail-
lrs. A.
rk sev-
lington
;s Mary
Mr . a n d Mr s . J o hn Ec h ten k a rr p .
Sr.o f Ar li n gto n ,spe nt Su:.¢1.:y
after no on a t W m. Holtr na n' s.r
E d i th a n d E th e l Jac obs,Vi o " ;
Ho i t ma n a n d N o r ma n ja c o b s w e r e
those f r o m here wh o to o k e i g h th
gr ad e examin a ti on s a t Bla i r la s t
Fri da y .
|'|~~~|:
their play entitled "Nora Mixesln" at the Fontanelle hall Friday Advenise in The Enterprise
Lallman
"|itt]@5éttE ~D|ham>sr event and the hostesses hadMcfjalvinHaynes,son of Mr.,a birthday cake for her.Mrs. R.and Mrs. Avery Haynes, died at A. Davies presided at the meeting
t home of his pamnts about 11 'and after the business was disocock Sunday evening.Alumghhe na ed with the missionary com
lcCalvin had been a sufferer mittee took charge A number ofl`0'f|diabetes for a #number of invited rtllests were present.
years he had been able to attondl Mrs.Hans Miller of Binir, hae
school most of the time and thebeen visiting here several days thepast Jrear he had been a regular past week with her-daughter, Mrsalten ant urtll two weeks :ign. H¢|Jav Blackburn and her: son, L. P.was born near Arllngson on June Miller.i-ith, l9lB and lived in this v1»°.n~|Mr. and Mrs. E. C. Fintel and a
l i y a l l h i s l i t e .B e s i d e s h i s p a r ~l r r o u p o f n u r s e s f r o m t h e M .E .
n i e h n i s ¢ . \ | r vi \ m | I n v l\ l \¢ ¢ u | ¢ »h n e n i h a l i n U m n h n fn n l r p h a r m a n fI POCKET KNEE?
\1 4 _;;..||0
lmld a t tl 2 Foulgzreg-ationai vh u rr h ever li ng a t th e re gu la r fa mi ly s un -
fues dny u f te mo o n a t 2:33 wi th per wh ic h is held a t th e M.E .
Ur. Ray mond rn. 'Swisher in chnrgue.hurc h. The Ladi es Aid had c ha rge
A BTO'-\P of five, Chas.W .-of th e s er vin g a nd ar r an ge men t o f
'fl}`@\*'S. chairman fo r P a wn e e dis t-the c overed dish sulpper.
no t of B oy S c o uts; A . A. Hah lb ee k C .G .Mars hal a n d Ve r n o n
G. G. Rose nkild e, R. E. P lanc k and Ma r s ha ll return ed F r i d a y f r o m a
C. C . Co ok , motor ed to Nor fo lk o n bu si ne ss tri p to K an sa s Ci ty .
Hume of Pe;/#cl Talking Prclures
I,
FRIDAY and SATURDAY
FEBRUARY 6 and 1
Saturday Matinée
Girl of the Golden West
With Ann Harding and James Rennie
,c om-:mr-swee c Pntwlie
THURSDAY
FEBRUARY 4 and 5BIG DOUBLE PROGRAM
I \L l h o m
With Charles Farrell and Rose Hobart
Outside The Law
SUNDAY and MONDAY
FEBRUARY 8 :ni 9
Sunday Matinee
pm, was looked upon only as al v | \ : | u l u I n u m
highway so the regions of fur and'
gold that lay farther west."The Blair hiah dchatersActivities in the line of cron im-I
pr ovemen t ana repimrted b y :He sides o f thx question i n the de-
c o l l e g e ,i n c l u d i n g t h e s t u d y o f h a t e s h e l d i 2 i \ t h e B l a i r h i g h s c h o o l
s w g e e t c l o ve r ,s o i l m o i s t u r e a n d a s s e m b l y 1 s s t ~ . § V e d n e s d a y d t 1 e r ~
.ID E W v n n e t l o q n f u n o t l A r n n n n 1 L . .n n n n u r n !n v n n i n n r ' F L A n n ¢ . ¢ f ;
\1 4 _;;..||0
lmld a t tl 2 Foulgzreg-ationai vh u rr h ever li ng a t th e re gu la r fa mi ly s un -
fues dny u f te mo o n a t 2:33 wi th per wh ic h is held a t th e M.E .
Ur. Ray mond rn. 'Swisher in chnrgue.hurc h. The Ladi es Aid had c ha rge
A BTO'-\P of five, Chas.W .-of th e s er vin g a nd ar r an ge men t o f
'fl}`@\*'S. chairman fo r P a wn e e dis t-the c overed dish sulpper.
no t of B oy S c o uts; A . A. Hah lb ee k C .G .Mars hal a n d Ve r n o n
G. G. Rose nkild e, R. E. P lanc k and Ma r s ha ll return ed F r i d a y f r o m a
C. C . Co ok , motor ed to Nor fo lk o n bu si ne ss tri p to K an sa s Ci ty .
Hume of Pe;/#cl Talking Prclures
I,
FRIDAY and SATURDAY
FEBRUARY 6 and 1
Saturday Matinée
Girl of the Golden West
With Ann Harding and James Rennie
,c om-:mr-swee c Pntwlie
THURSDAY
FEBRUARY 4 and 5BIG DOUBLE PROGRAM
I \L l h o m
With Charles Farrell and Rose Hobart
Outside The Law
SUNDAY and MONDAY
FEBRUARY 8 :ni 9
Sunday Matinee
g§an'}»}§és£ffrQ'"l m u g e p o n t f m n d
" D r Pn nc ke . h ea d n f th e Sneech he re sh o rt ti me 3 80 -
U =.~|=.~1
f ..~=
A 4 151' L.< . .
éib :1.§~, 1.rf# .<%'"
»;`,H ss];§§:}!r ~ 5;'f = "z J4ii ,:"3~ ~.P i = § ¥ '* M >+ JJ 'I 2
~ 1|
`:"\»-ff /(
such forces as are needed for
police purposes..
In the af ternoon Gebate,Blair
upheld the affirmative.The Blli;
team consisted of Alice Beckmaii,
captain; Roy Christensen and Reed
O'Hanlon.The Lyons negative
team was made up of Helen Mc-
Monieu, Gladys Loomis and Louise
Hain.The Lyons tenm had had
several years of experience in.de-
bating and are all seniors this
year.Therefore, thzy gave the
Blair high debatera a very close
debate.There ima very little to
choosebetween either team in con-
structive argument, but it was the
WHEN BABIES
THERE me time
~whe nababy ialoolmthd or fevuriah tobe mn| w » l e e p . Th e ma m| o ma
pdna a mother cannot pat away. ButUufda quick comfort in Cutorial
For di urhu,and other inlandkAlla, dvethigpnxn vegetable prepara-
M w coa ted tongues tell
al eo ation; whenwa than any.gn d llugdshnss. Caaloria hu |
amd tale: children love iolah KL
Buy tha genuine-with Chu.H.
Fletchda aimaatun: on wrapper.
,g .CAS T O R|
¢ "
Hume of Pe;/#cl Talking Prclures
I,
n v a r and 1 ma n a !w m f u n m
h u n a shall la nv y wma mu lled
lm lu , v q e u n l s s . m ll i. m a p . h h .
me nu . g g pu ma. u nd co nd lme uu .
The nlnz lndu stry many h u
vlme d \new pre mlum on hesuh
and mule n possible Im- ewan tha
°f x. ln ° I \ \ ° < l n s - mm , u wE e h m l lf h i e x la w k h . ~ » . ¥ § . t h e
en a rg y f o od l. mln a nls a n d the lm-
w f u m n u m l n u .
l l u l n A c r u m lo a n y o u h u e
plmn ed fo r ' rn ss d ny lu nc he o n y a n
have merely Lo choc k y our mp p lle u
to s e e th u r m: h a ve n n u n s ! lo n p
m d e v n p o n w d mllk .lr n u so
be eodnsh \In mo d s fo r m a y
chec k for |c an o l e o d h h m d
more avan ornz ea mllk.An d so o n
Lhru uxh aul u m vo a k : l u x n o m :
Io n l a n d l| c r o wd e dBllln i se d Din ner Ma n u
.,c "us: aes"maa»|»»u'=»a~=-._u2§.'2f-.»-
enum.-anv- Bald n u n n a nYleldlll uma own-C n n m o f C e u r y S o u p ~
ae vvn u lmle d u - r S u o a b d l h lI n v t w n u r n wl n u m b u u g l u m r n v s n ulY-hn»loar | |m mn al l l v u s l l
C a r c e le r y l n n m m m ! u n -
der.lI>n1xL P u l e e l o r v u l m n |
fo o d c ho p pe r md nu n -n u» li q ui d .
P r e v u e A w h i m a m e n o l u n b u fu r .lln nr u l l ,bo llln g n u r an dmmf .A d i w o n . s u m v i m v w
no t m d m e k o u r h a n w l o
ma mma .m u a n m d m e ual o a m m m m v l m m u l v -c o o k a
m l n u t u lo n n v .Se rvo sz m o s .
Yla ld :e u r v l n u .
¢ 0 d | \ d \ a u Mo d a
as-.'...-jm.:-g. ...,.' A 6 ann a-u na r e n a -
l u m i n t n d l o n u m e h h a nm a d t r u r c v l n 0 5 0 °m 15 I n
zo mln n mm A li ttle onion o r
FRIDAY and SATURDAY
FEBRUARY 6 and 1
Saturday Matinée
Girl of the Golden West
With Ann Harding and James Rennie
,c om-:mr-swee c Pntwlie
THURSDAY
FEBRUARY 4 and 5BIG DOUBLE PROGRAM
I \L l h o m
With Charles Farrell and Rose Hobart
Outside The Law
S U N D AY a n d M O N D AY
FEBRUARY 8 :ni 9
Sunday Matinee
Sin Takes A Holiday
wink Consumer: Berne!! and Kenreth M2cKenluHUMANETTE NO. 3-TOBY Lux.K MAN-Fox NEWS
TUESDAY
FEBRUARY 10Glassware Night
Lord Byron of Broadway
With Cliff I-llwnrds
%MED¥-Ki ddle l Be rne
\mBnUAlzY11 and 12DOUBLE PROGRAM-2 Shows f r Price of One
.s w m o m o n
Wi!h Helen Twelve/hoes
L O V E O F L I L
With Elliot Nulen\Ind Sally Sturt
COMING. FFR. 13 and I-I-»-"I{;!f Shot at Sunrise"
FFR. I5 mv* I6--"f.`"c's :-':'l Doubie Check
I j ' " "'| .'|/ '. L L i i '¢ g _ ; p »
. : § L _ - ; ] \ E § ; | ' : <"1
.~, " ; u » . .~f
1 -..
-"|r ,.
I
..~-ITD:--...
.{`.f
../ Jga \s q .~~i
.~~ ' g . ~lo ;
i f f *T 'f.\
1
.- < f ? 5 z m ~\ "
a m mi lk m d i n t e r I n to p of
u m m halter no moulding palm.
B o a o n e y o l k m d w o w h o l e a n
un ti l tommy.Add m m md , a la ,Po u r th e no dd ed mi lk o u r n n .
lt i r r l n l rigorously .H a m m r Lo
dou ble boiler m d cook over hoc
unter. lUIl"|-G18 oontinuoolly . Whoo
th e mi xtu r e oo u u n s p o o n r e mo ve: m m i n a n d l d d H n lf o r ln l .Pour
i n to c u a u md o wl. Ou r to p s p r e a d
mo r h g u e u n d o f r o m th e wh i m o f
:b e one ou r and I tbsp.w w .
Br o u m q u i etly i n a h m ove n .P u :'»i tb s p . J e ll y o n wo u r n e u can.
Ch ill l h o w d t h i r b e lo w c arving.
Yie ld:4 l l I ' * l l ¢ l
o n e - w u » u n c ¢ ¢ k m
I e u n t h h .~
- _ - ; § _¢~;¢s a u u o f u n
:°:..."............* . : . .° '. ° " ° ° ° ~ '
u n i m m al u u o p u u v t o u0| 'onm ¢ u ¢ l r \ l d h ¢°\- ¢¢ | g g|
I y : u l d o ¢ x u d o o l t ! a u o e r u . n , | m
un ti l smo oth Ql d K a l b .Btlr i n
ehoooune th a t I n boon m o l u l
u v n n u n w m u o w l a m m y .Sltt th o U»ou vl1 n th o . lo d u u l
w t t v r l o e u d a d d o l w r u n u l y w i t h
xho m i l k l o t h o u u m o d t s l t t u w
un ti l n u mended.m e th e n u n
m d n u l l ;thu L u z . u w n u n .D1-oo hy th o lo o o nf u l ouno oilod
u m .B a n tn a hoz o n n 0 7 5 '
5 .M e a l s P l a n n e d A h e a d ~-1
'Lighten Crowded Dayé
OW dn: lrridn elnbl. mn
l u a rzmnwo n n u n u n .mxunoe|..uad umm spama n ln lul l Gln ; un pilot or themydlou homehald mm plum herduuel ln M law hor ervldod mm-
v mw p mgn m.The spcrsrot he r :moa n lieuIn nl:-mains hor muh |veal \nadvance, with Lho Lhoughl of theq m x m m a ! l o r n n mm m d u .In planning your me nu moreus sunken .mu nm cannon slam
uldldoanl Uno:-,.Ywd:o n n
intl-
l l n n n u u u d
l e a n s :' ° : ".. .. .. .a . . . _ .
s .59
~,fffylnlf 'w 4
Fioulng Inland ~
u u a u n sn u m% ur lu nu m aI lbw. eu-msn'un- HU
provemenl. work are field erosionwhichgm-ries away the fertile
upper layers of soil and crop ro-tation to maintain fertility.
Development of a hardy alfalfa
for Nubraskn,certified seed pn-
tabo work, und the fight against
w¢¢¢.|, insects, and plant diseasesby the college are all ied in
the report..
In 1920,nays the university
publicition, the covis M the farms
of Nellrauks averaged 125 pound;
of butter-ht aru\ually.In 1929,
i t rffnvm.they averaged 175
pounds. or an increase of-40 per
cent.Dairy herd lngzrovement ar-
locinions, ul! clubs, judging con~
mu; and other activides sponsor-
ed by the college are vredibed with
hdpmg promoic this increase inpmduction, so that the state now
ranks fifth as a producer of all
We°d |i|¢e td have you
try it out on the baked-COATED
HARD on the |<nile,but
a mi My convincing!est| v°..%| haveetough time
gettin through to dw stee||-....4",,.,..~|| decide that this
moisture - proof, rust -resisting
:feel post ls the kind qf po:
dairy produgta.Detaikd infomation is given of
way:in which the college his
helped Nebruknns.It reports,
for instance, that 10,000 lahora~
tory te.-:ts were made last year in
mimal plixease cues; that 10,681
blueprints were mailed to farmers
during me lm two years d¢»,»n.\
ing ihe construction of better farml
bulilniixigspgngl that about 2,5W,00G
tree; have been dint:-ibuled by thecollege and the Nebraska Nationalforeit durfng the past five ;ears.l
Other subjects are given eq\u\l`
considention md study, the report;
shows.`
The booklet is n valuable refer-
ence lor xnyone interacted in Neb-nka hgdculqure,slate Univerdty
authorltietaxld will be sent free
""&"..f§'"w.,,k in but one s ec-
6ono! the entire Edd of work of
the fUniversi¢y of Nebraska col-
lege; of agriculhxre.Other lee-
tionq, of eqw importance, are re-'
gguph md study of new methods
of doing things,And then cJn.ss»
maria instruction,wherefssxudentlma lcquire the result! o 's`i~e-Y h.1
if
you want ln your fence lines.
And don't fo et dm t||ere's anEXTRA coat ogtouglu black alp|\a|-
turn to a point above the ground [ine
:o protect your post underground.
Easy
Change
Y o u r
Lines
A|<»¢s¢|P,¢.¢|n as.."»fl§| ell fs, ,'1,...f.fZ..f'F§¢§f"'\»<¥»3.°'1|.. cmbcngzm
Ankorlte driver and pu||¢r you can pull and md the posh
In len time dunIt takes to nik about l¢|
».| ._ ._u._____ _L_. .l___Loa n ln--lu lu un ou mon |oovl mu!durdv GREN and §LACK steel nam.
RIVETT LUMBER
8* COAL COMPANY
r¢-un~~..»»¢n¢¢4|».»»a»v<d»ns|=1c».n»L|,.s.=. r~,.cu...,.
Wash DN BS-$1.95 values ~
n t i i - d n » | |. w l s ; yvn w l u ; y
thqu e a nal hrnin vdrm yw
* T m nnuoncanm.a-xg
~n m m m m m m y s w s m m
.-¢|i¢»nwum du1¢u»2s;¢.
Bhlr, Nebguh, Fehnury 5
|»@'§"Pl'€"'ass
Subgeribe lor The Enterprise.
numlmn. rugs end floor cover-
ing.,lhthew R. Bendorf..21-ti
u m . - A pnlr of hi m; a nd Im-
hounda.Notify Hugh Sutherlxnd.
Phone 1221 on 88.4-lt*
\For Sola-Cottonwood Ind B6x»
lelder seedlings.Leave order at"fha Em rprlae.so-a
For Sde--Spotted md Poland
mx -. . .. M Anim' N. Andersen.
m u x .Bendorf,Unda ruklnl Adverlile in The Enterprise.° 'Por Baht 'Improved Yorty nee!For me o r Re ne -.A fiv e mommd|_m|u|_m¢,service.Phonu:P m - m u m , m p m d f l o o r ~S. w. Chambers.8-20 house and good Duthuildings, with
voffice, »su(»¢daeme. xsa f m ! ' " ' ~lhthew xr. Bendorf.
..Mondly on budnees.will g=;g_;f-4-Y #twins at the Vina Tolley of Elkhorn,
paris .Mr. nu! Mrs. John C. Andenen ggmg k at the J eny
Uni Mary Barry In visiting her three une: of lmd.0. A. Phlppin,
son,John md family,south ol 608 aut South St.8-3t'
WWII. this "f°k-Clmnnc c Sde - Si lk D re ue a -
lhs. Drune McCann of Omaha,Values va $20 go at $7.95 undwas x guest of Mn. L. D. WnrrickfValues to $10 'nt $6-sizes 111-lm Friday md Sltnrdny.vo aa Fumo ns e n ur.s~1r
The um-led Folks Dancing Club s w. cumom went *°
spent
Foley
and Hrs.Jean Heinzex-ling drove u.......| u..n Q1 r-,.f......\\ nfl The M. E.;-hurrh member: en-|Mr .mi M...1:r'n.f:.-..u ..._
Fmnm, r un a na fl o o r -I For Sa le-Twm p .Mathew R. Bendorl.2 1 -l four coming ¢.';.{'"°" eow:'h|rul
Miss Eloise Morris lun been ...Wg 122 an 18.P . J . ~~
ins the prevalent gzippe um pm The w. n.,c. Remington will
few days.imeet Frldey, Feb. 6 at the home
nw, L y le s me ulm o f mn,-°' Mrs . J o hn "¢ '2 ""H°~
South Dakotl, who wu n former,Ex-not Carpenter of Fremont,
,was Blai vidBlairboy. occunled the nulnit at iz.-...S ....'.....f'1f.'{".,§'3"'f?¥'
¢.
Wanted-Some fall pigs.Phone;""'°'""""' "' """ a_2 ga Fremont Monday.21 °" sa John I-looks.a-1:erman.m l n d c. L Human, mama mmm-|wm¢¢awBuy-somu 1 erandund s m ;oHighest prices pald for produce..m m asa Farmers Produce a.f§"::'_;m Call 2211 on n Vf,;lf; phone, 161; rea. nhlm. ma w
'"bo little dau hber of88-11 N rma nz.sIMm David Mummen.was -|w..'L..hmv in mnnh lmnxoved
wZ»"4.E`k."€i.` 3 Z ; J . ; ~ i m a I " ; i ' a § . ' i m . ; ; , ; . 2 1
home last Sunday.the church pulors lm evening.
Mr. and Mrs. Leo Sn-.luniu and Mm W. M. Haller and son, Ted
children of Omaha. vlslwd at the Qent the week-end in Om d vAndrew Feer home Sunday.H108 All-ltin and Bill I-laller.
,___ _ .... ...__;n..\|..:-m_--.-..-f nn..-
I v o | 9 |l l . ;` |L l n u l u x l c u "t h C e i n I n i l i l L \ l l l l | € | | ,as ~r n -u m m e d a t d u m e r l m s d a r e s u n ;S \ l 1 1 d l Y i d e n L a n d f o r u _f m m n g ,M r .a n d M r s .m d g l y e r f " ° ¥ ' i E " . W ' . §= : ° " = ' = ° r q f h i s f q r m e u w i t h t h e n $ E » . . T 0 §m a n y c o .
Mr.and Mrs.Murahdl 'Tyson
and baby ofomnha,und W. P.
Turner of Tekamzh, were dinner
kuetta last Sunday at the M. E.
~il home.
er school friends md clmnu whom
he lmew here ln his youth, gather-
ed at the church w hear him ulk.
The evening wu n very pleasant
one for both speaker md audience
and the _lqv i i ng dnt a wni ng dll
long bekemembered.
I Carl Petersen of the weate
pan o! the camty,-xs to hold
publlc suction G! his fum elm
on February 10th and will
69 Oedu-Blnfis,Neh.when
will go into u partnenhlp with-
son ln the automobile business.
from Mrs. W. w. Ptautz of Beloit,
Kanau that her family was qugr~
nntined nt qresent, with mm pox.
n -
Ty|°¢,,_
vobums: 5 Blair, Nebraska, February s, nest NU ~an asmat at the"home of Mrs.Z.B.
Smith Int Friday afternoon.Tho
holtesa wu ldlted in serving the
refreshments by Mrs.Chu. Mc-
Bride and Mn .An n rl Petersen.
Theme was n K°0d attendance.
Mr. and Mrs. C. W. Chdstensen
entertainédfnt 1 plnochle party on
I-'rlday evening._Th were threetsbles.High acoréae;ere held by
Mrs.Geo. Ruhr,Ir. a nd Otto
Kuhr milqw :cores by Geo. Kuhr,
Jr. and Mn. Om* Kuhr.The honff
eu served dee refreshmentr.
The following Baptist members
attended the Ornnha Association
meeting last Friday: Mesdsmes L.
J. Moran,C. E. MeComlz, Elmer
Pate, Grant Gamer, Cora Badge~
row,Qruce Mcldlllan, Sophia Reeh,
Ernest Tomblad,Wayne Pulman
Chas. Lamb and Geo. Plckell.
Mrs.C.B.Hansen entertained
the following friends last. Monday
f.:°Z:rnao:1, the occasion being her
birthday:Mrs.B.H.Watson of
Omaha, Mm R. J. Andrenson, Mrs.
R-ny Casey and Mrs. Harry Blaco,
all of Kennard and Mr. and Mrs.
J.D.Jensen,Mrs.Peter Svend-
gaard and Mrs.H.Madsen of
Blair.
A man is authority
for the s u wm m
that therre workingnew on a x'6o\-pmol
airplane.I !they
figure que out, it'll
be the only lool-
proof machine we
know.myt.hlng about
A lady mme imaour More last Satur-
day night and wld
us the "Glow Maid"
Range in our win-
dow was the mos!
wondedll R a n g e
she had ever seen,
and we agreed with
her.
THE HACK SAW
an old-timer in tho
westem part of thestat?tells us that
one year the grain
was so low the
~o~n on théir kn~es
to reahf the kernels.
words - "Nb more,
thank you!"
Be sum you a n
right.but before
you go ahead lt'|
ufa m e o nnl t t he
wife about lt.
Peacefully sleeplnnz
In Jonathan Placid
H e sHr¥*¢d h i s
throat_ Wllh/carbollc acid
One thing we wouldlike to know ls why
the sole of a sled is
called n. mnner when
all lt does ll slide.
We don't know wha
ther w believe that
or not.
Commencing nextMondaytherewill
be a Rmdlo Prvgpain
featuring the "Glow
Mnid" Globe Rmsv-
It wi ll b é " 2 t h e
WOW nnd don h i ]
to tune in ns there
will be something
real interesting.
The reducing class
will be lntereswd in
the newest reducing
method.It consists
of saying just four
|O l
li f e d o y o u spe nd
ta lld n g t o people
ab ou t oth er peo ple?
He a te r s i n stoc k.
PETEHSENHAHIIWAHE
Boy und Ray BoyBlair. Nebruka
\ .
C°l|P¢1' Clad R-mn
lilul ami durable.
mo n t b e a u- ' "
T h e A m d !|»,
2.1!
Ir u a l vvs I ~ " " o r "r 'M r s .E a r :C a l u w e u n u r e c u m e u u l .s u s a n :D l l u u u b v u u u u n u -E U B I R V i l l t o I . ' I t t h e W . H . ~a f t e r g g g f f o i m t t h t n e a o t a , s p e n t t h e ~ ~ h g fO R IG i n L i n C 0 ' | 1 -J l l a : n f l M m C h n l R p v n n l d r O f E i t e r a ? o E . } E _ { t e E - B \ 1 r ' i l . E I i n l i n n t l n e r H i ' 1 A n n a R i m n n u n n '
l l n m l a u a s n n ";;,§';..§°§,;.'"§7Gi"f e:z-
.tnrwned at dinnen'hat Sunday
for Mr. and Mrs. Chris B-endorf.ir
F
Wanted u Rgntv*-'!{0||3e with s 0 aha nt the Burl "f"`lntlaer 0'Hanlon in the new mug 13 :cm of ground.G,¢,_ H_ Vzxghr; ~ on Sunchy, .lm g5_~ ~ w -s_§»f_;=1=
|dw parm dzputmmmt at *-*\°.s¢hn¢r¢r, sow E. South sn 2-zz mm sophh Manda of north of Q; Jo E,;,_,,,, home.y .
'ard ¢lns¢-1 aw.,.M Mm .mu McDonald .,.-.-_-. . ,»=..... ,....» .1 tha ,_.__.
Sx|Te:\head of choice
Jersey gilt!no hrrow in
W. J. Novlk.8~1v.'
Sale--Banedjiock coékiiréla
Hatching eggs,sa m pe r
hundred.Phone 221 on 36.Oth)
Rowe.2»8t'
.\. R. Beales has nntod thc Nor-
|v.x.n Wilkins farm and wnL,movefrom the Ware fann to thi Biw
. _ . , _. . _.
For
DameApril.
For
szoo.
i
D u n -.. .. .,.....-.» a---' '- '"'Jim. 3-. cuugher home Sunday.Mr. "ax" w`¢s»l-afxggmiizr
The I-»~I ; ' " ' " : Z , ' * : ~ r e l a t i v e s a n d f r i e n d s
¥r§*§"§.n this evening, Feb. 5.f~_;_§ g B l - L g m .
Mr.and Mrs..llmes _Mead of phqm. 161; rel. ,hm 1g3_34,1
Sioux City are here visiting Ltthe Mrs. Chris Bendorf is entertain-
parenul. Dr. c. R. Mend home.mg the y w ns mu r h d u m m
o f M r s . He l e n M e mm m m m!For Sale-Six head of 8'\°'* budge °'"'° this (Thunday) ""
u2l'io\l.\lY"'l'll :with nppendicltls but work h ° " " 'ho m three m 'f" no on.a. |..»n»» ni nm time.I W o l d .Ph o n e 2 } 2 .° " ~For Sole-Two some an new
.,;.;' u§ £"p§ &Iy § é§1» §{}£ um'
Enid Petersen home on east South
sweet.
Mr. and Mrs H. Schuldt of Elk-
horn, nude a budnessirlv toBlxixSaturday md wled on~Miss Vina
Foley.
Charlotte, six year old daughter
n o p u u s W I !i n u u A z n u ~
mee at the hxrdwnremexfs convezi-
tion held in Lincoln lan Thursday.
A Z°°d_ 6~room. house vyell lo-
cated for sale by Much l, $1'l50.
2-It N. Tl Lunl & Co.
A. W. Rose has gone to Billings
Montana, and expects to vidt his
dgughter at Reed Point, Montana
before returning home..
Mm. Byron Bunn and elllldren,
| 9 ¢ l " ° " |Hv l - lC I l l » .'|" " " " " " '" - '" ' " "I l , "1 1 » w . c . ' r . U . w m m » ¢ ; ¢ 1 u = |' n n m m B = ° f~ l = = r 1 \ ° ° 'l m d u r m a
l n .s a m s m m ,s o o E .s o w -2 9 5 9 *_ * P ' i ' : _ P . ' : P ° & ': " " E ? 2 " . € | . . . = ' N . » ,
gg " ua r wx ; he a ti ng - w ; ?-her:¢dl'¥ 1;-== of who reside on the botwm, Went a
Mrs .F..a n o nhl Will nr t e.'~thuk: streetgenlzertalzned ergpirodua Co.50-tl $,°'"'f° 3f-'ffT'i-§"f" week at e
m e n T h u r s d a y a l t e m o o n ,F e b .a a n c e s a t m e m .vv .A .n a n
1 2 l t s P . M .| " ` " " " " > 'e v e n i n g .
W m .B r a t t h u n w d t h e E n g ,M r s .S a m S t e e l e ' s l i t t l e d x u g h -
n m i i e t w o h u n d r e d m e f o n y a c r e Q ' 4 l ' »E v e l y n h u s o f e r i m p r o v e d
farm near Henman, and will take
pouesainn March nn.
Dick Flynn of Ord,Neb.,has
rented the Rubens and Rose ranch
and will take possession immedi-
.ately after the sale, Feb. 13,
Mn. hlary Lutz of Ft. Calhoun,
-was n guest of her old neighbor,
Mn, J. H. Bowman of west N;b~
fanka street recently.
Sdls and Overcoau.Firstclxss.
Reasonable prices.Theo.Wahl-
atrom with A. M. Lundgard, Coun-
Lil' Bluffs, Iowa.30-26t
Mr. and Mrs. James 'l'. Nelson
entertained at dinner Jan. 25 for
Mr. and Mrs. N. T. Lund and fum#ily and Mr. and Mrs. Ed Gilbertson
and Myrtle.
Mr.and Mrs.Andrew I-logmi-'
sen of Craig, and Mr. and Mrs.
Henry Rasmussen and family werevisitors at the Delmar Feer home
.Sn:|day..._
)l:. and Mrs. Chris Wrich and
family of Orum, visited at thu
parental,Hnns Wrich home on
west Washington street last Sun-
day afternoon, .lan 25.
Lani; Amxstend has been having
a rings of tondlitis and has been
nrble W take up his new duties
at the Citizens bank as yet.llchopvs w be nn the job soon.
Mr. and Mrs. Harvey Kroghandfa-nily, south of Blair were din l
ifonfher recent operation that she
was :ble to be taken home Sat~
urdny.
Mr.and Mrs.Chris Wilkenlng
and two daughters of South Oma-
ha, were dinner guests last Su:\~
day at the leonard Axwll home in
south Blair.
Mr.and s.Otto Wrich and
children who ve south of town,
visited their pfrents, Mr. and Mrs.
Hans Wrich of west Washington
street last Sunday.
Mrs. Anna Simonson held operi
house tu her friends at her homo
an west Washington street on last
Sunday,the occasion being her
birth anniversary.
Mr. and Mrs, H. W. Meierhenry
entertained at dinner last Sunday
for Mr. and Mrs.Walter Meier-
henry ofwest of Blair,Mr.and
Mrs,Harold Smith and little
daughter, Pearl nonh of Arling-
ton..
Mr. and Mrs. Jack Crowdy nrld
daughter, Bess of Blair and Mrs.
Hans lebbert of Bennington, were
guests at the John Jensen home
nest of Blair last Thursday evc~
ning where they played cards.
Rev. H. Nielsen, retiring pastor
of the first Lutheran church of
this city, will deliver his farewell
sermon Sunday moming, Feb.8,
at ten o'clock.The following Sun-
¢
'about thirty of the L.L. W.B.
class one evening last week.
Mr.and Mrs.E.G.Carson
spent the week-end at the home of
Mm Canon's uncle,A. J. Clld-
mell and wife at Walthill, Neb.
Mr. and Mrs. Wm. Morrow, Mr
and Mrs.Clifford Munson of
Omaha, visited at the E. M. Ter-
rell home last Saturday evening.
Dr. and Mrs. M. E. Lawson of
Rockport, Mo. spent the weekend
in Blair visiting at the parental.
Freeman Tucker home and old
friends.
'l'he Thursday Aftemoon Bridge
Club is meeting with Mrs_ Burl
Vaughén this alternoon.Mrs.
Chas.Reynolds of Omaha,is an
out of town guest.
Why not have a Duart permanent
that gives a natural wave?A real
bargainat$5 and satislactionguar-
nnwed.Call Mrs. M. Sutherland
at 4l5 for appointment.46-if
Mr. and Mrs. Chris B. Hansen
entertained a number of frimdg
last Fdday evening at pinochle,
there being ,six tables and a very
nice evening was enjoyed.
Mr. and Mrs. Erne.-xt Schmidt of
Fremont, were visitors at the H.
W.Meierhenry home last Friday
afternoon.Mr. Schmidt is a bro-
thel of Mrq. Meierhenry.
Mr. and Mrs.George Caldwell
entertained Mr. and Mrs. Morris
Olsen, of Lyons, Neb. last Sunday
The ladies are sisbers and Mr. and
°Uday, the new pastor, Rev. James Mrs. Olsen were Just married beno r mmm; mm imma fn.ae..in u..,,|J H-..|_._,_.....4-.-._ ..-..=.... .»....... ._ mA.-
The Ladies' Aid of the First
Lutheran church met Wwnesdny
dternoon, Feb. 4 at the churui
parlors.
Mrs. E. s. Bcity returned Myri-
day (rum an over Sunday v mt
wim her brother, Dr~ N- J. Mmm'
of Tekarrmh.
Mr.and Mrs.Harvey Simpson
o! Tekamah,were over Saturday
night visitors at the parental,
Frank Simpson home.|
I offer for sale my Belgian druft
stallion, Marquis 12966; a\so a (mepedigreed Jack.Call John Bolln,
Blair, Nab.60-ff
Mrs.J.w. Tuttle of Bensuru'
spent a week recently, vdslting_ nt
the homes of Mrs, L. D. Warrick.
Mrs. Mary llnin and other Blair
friends.
Mr. and Mrs. C. G. Halbert cn-
joyed n short visit from Mr. Hal-
bzr't's cousin,Glenn Foust and
wife of Red Oak, lows last Sun--day afternoon.|
l will _rell twenty-five head cf
yearling cattle at Andrew Reck's
farm sale yvhich is to be held u\'|
Wednesday,Feb.l l ,Rudolpff,
Mencke._3 4 V
Mrs. D. W, Compton and daugh~
wr, Bernice, who live west of Cal-
houn, and Miss Irene Larson of_
this city were dinner guests last
Sunday at the D. A.Compton
home.
Mr. and Mrs. Herman Abrahan
who are staying with Mrs. Abra-I
ham's silter,Mrs. Vannoy,cnm12_
n. A. n-au nume .
A report comes i n this office
that the Bohs Cesh Stnre hu been
sold to outside parties and pos-
session will be taken soon.
Mr, and Mrs. Howard Jensen and
children, of west nf Blair,were
guests of Mx. and Mm Walter M.Nelson last evening.
Regular $7.50 Permanent Waves,
$5 and $6 NOW.Either Croginole
or Spiral Wind.Phone 197.Mrs.
xr. A. Pound.28~tf
Mr. and Mrs. J. P. Anderson and
daughters,Florence and Evelyn
were dinner guests last Sunday ut
lthe Peter Nielsen home,neur
Orum.
The Past Noble Grand Club met
Monday afternoon at the home of
'Mm L. D. Warrick where they en~
joyed a quilting party.The host-
ess served lovely refreshments.
Rev. and Mrs. Lyle Stricklett of
Ethan, South Dakota have been
visiting the past week with Lyle's
mother, Mrs. Louis Stricklett a"'l
other relativa.
Rita, little six year old daugh-
ter of Ed Rose 91 Tlurd and Lin-
coln streets. celebrated her birth-
day last Mondny evening whenabout a dozen relatives and friends
mme ,in and surprised her.lee
cream and cake were served and
all had a pleasant time.
sl m p o r l a n t .
The\
'rn-mlF'r 'rwlNs
.' . -n u - w w w Q - u u | n . . n |1 n u U n ,u u i l l u n u 9 1 m e o l a 'I O W I .~~l n »# U I C c u l l l l l l g U U W I I L U D l a l f ~~~~~IteH o w a r d A p p l e b y h o m e n e a r n e d '._s t a »M r .a n d M r s .C .W .R i c e a n d d ,i h ' f i b e e n a w a y a |~
P ' °
_ ' f '" m f f ' " d " > 'J ' ¥ f '2 5 . ..I M r s .M a r i o n S u t h e r l a n d l e f t f o r f a m i l y o f O m a h a .d r o v e u p S u n -w v e n m g a n s I ( I I G V C I O P C
1 _ 1 - ., _ _ _ .L . r r ».f
=Z f '»..~~.r`m y .:g \t.v ~~
~' ~~l x "2 1~
£ » ¢r QS*.3 Q \ ~ g
When you trade with us you practice true econ-
omy because we make an effort to givereal vglues
in everything we sell as may be seen in the
following list of prices:
- r
ocolate Marsh Mellow Cookies ~
40c retailer specialperlb...
PURE SQRGHUM Colson I0 lb. gan $1.20
CHAMPION |`¥LoUR 48 lb.sack
e v e r y s a c k ~ u a r a n t e e d s p e c i a l ~
PURE SORGHUM Colson 5 lb. can 651:
I CHAMPION FLOUR 24 Ib. sack sfiecial 69c
FLAKED HOMINY special 4 lb.251:
CHAMPION |`¥LoUR 48 lb.sack
e v e r y s a c k ~ u a r a n t e e d s p e c i a l ~
FLAKED HOMINY special 4 lb.251:
PURE SQRGHUM Colson I0 lb. gan $1.20
ocolate Marsh Mellow Cookies ~
40c retailer specialperlb...
I CHAMPION FLOUR 24 Ib. sack sfiecial 69c
PURE SORGHUM Colson 5 lb. can 651:
Bulk Coffee Santres 3 Ib.69c
. i A .E.". "r .
W j n t..f *.1.~l \I ,~. ~9 ~'3
'< 9 ¢"ea-~.cs m~f as 2
When you trade with us you practice true econ-
omy because we make an effort to givereal vglues
in everything we sell as may be seen in the
following list of prices:
- r
m
mr. and Mrs. J. Hilton Rhvadeqxirksviile, Mo. last Tuesday morn~vntertnined at a waffle su r last f fPWIng where she will undergo an p-Fnday ovemng (or Ml-ises Alice eration. "She went down with B
Jensm and Ruth Duryee of Lin an rs E Moat "J w-"d M ..g ho illc om-*`°l"»Mr.and Mrs.Earl Jensen,:h{-,e business Witlipleasure and
Q f Petersen and Leslie -lenseniyisgr rheir daughter, niilared, who
day and visited with their cous-
ins, Mr. andhdrs. John A. Rhoades,
Mr. and Mrs. Philip 0'Hanlbn and
Mr. and Mrs. J. Hiiton Rhoades.
The Teachers'Monday evening
~ club met with Miss Wanda
w w . . .
Mr.and Mrs. J. P.Sorensen,who reside,80l.lill of Blair, enters-
tained at a duck dinner last Sun-
dgy for Mr. and Mrs. Aifred Cor-
nish, Jr. of Omaha, and Mr. and
Mrs. Martin Btrtelsan of this city.
4 in
>i2liTUnAL GAS4
W i l l y u u t i n vc s t m e n u b e n c h : fr o m t h e
l»§»¢ ¢¢~l h r n t r vr ; r l . u h l r h I h r t d l !-
Min Alice Jensen name home
from the slate university on last
Tlxunday for a visit with home
folks over Sunday.She brought
with her,a sorority sister, Miss
Ruth Duryee, who was a guest at
the Ed Jensen home over the
week-end.,
Mr. and Mrs. Hans C. Sorenson,who reside north ol Washington'
is rn n\ll`5éS training mere.
Mr. and Mrs. .Karl Christensen
entertained five tables of friends
nt dinner last Friday evening ful-
lowed hy pinochle.Mrs.Oscar
Gjlberfsnn and A.C.Debel held
high scorcs and Mrs.Henry Jen-
sen and John Rhoades low, all re
eeiving appropriate pdzes.At a
late hour, the guests left for their
homes having spent n very pleas-
Wilmore at the L. C. Klopp home
on Feb. 2.Mrs. A. R. Beales won
first prize and Miss Edith Hokum
received the cut prize.
Mr.and Mrs.Ed Michaels ofOmaha, Bpent last Sunay at the
John T. Gallagher home.Mr.ann
Mrsl Herman Anderson, who live
south of town and E. A. Stogge of
Neula, Iowa were also guests.
Mr and Mrs Frank il h..''._.' roheh. were business callers at 'I'he'ant evening.l...,<,|-_-..rt .-.r ..-. YT" Y" o
Mr.and Mrs. E. E. Holler of
Beaver Croadng,spent last Sun-
day at the Sam Haller home.Mr.
Haller has been confined m his
bed for the post four months and
there is no change in his condi-
tion.
The W. M. U. Quarterly of the
Omaha Baptist Association wasentertained by the Olivet church nfl
Omaha.It was well attended by
;:i.;.;;.r.1.:,'.Ta's..1;;';a a:;;.;.;
rd indunry? Thzy will if Wu svnsugar: smvlce rnusr SHARB.
Ohh: 33 elc¢¢ricand\|¢ili!{¢DmP¢14l§=lrcprcscnzzd in the pnrtio io. a :hind
have extensive mrural u rnrcfefu.In addition. the wide xvemhcauonadurded by rvsucssa\'1a'muSrSIlARB|hou|dgiveyouxiuil\hsreofthe bendiu (mm orhu development:dhi¢ are mncribonng to the rmpndand steady ,mmoi eva-ybranch of
Anrricm mlwlic militia..
I
n|
.|L
present.Tho se i n atten danc e ne-
por t 9. ve ry fi ne me e ti n g wi th e
to ta l atten danc e o f two hund red
an d fi f t y wo men .,
Mr .L lo y d S.Breeder:a n d Miss
Ka th er in e L .Tib be tts,bo th o f
Oma h a , we r e ma r r i e d a t th e C o n
gre gation al parso nuge Saturd ay
J an ua ry 31,Re v.A .F .Ne we ll
off iei sti ng. Th e y ou ng c ou ple we ze
ac c ompanied b y seven o f their
Omstlht a n d F r e mo n t frie nds,an d
are to` ma ke thei r ho me i n Oma h a
wh er e th e g r o o m is i n th e radio
business.
Th e Misses Bernic e a n d Gla dy s
Moo re,assisted b y Mr s .Sc ott
Robeson we r e hostesses to the
Bspti st W orne n's Miss ion Circ le e
Thu rsd ay after no on a t th e Moo rf
ho me o n we st W a sh in gton St.I t
wa s a splendid me eti ng ,wi th th :
l l s o n stu dy i n c harge o f M i n
Fmn c e s S mi th a n d h e r g r o u p .A
nu mbe r o f vis ito rs we re present
a n d a mo n g th e m we re Mr s .Ma i
mi n an d Mi s s E d i th Sorenson o f
Dana Cb llege.Miss Sorenson sang
and her c on trib utio n was muc h ap~
preei ated as well as the n umbe r by
Mi s s Glad y s Moo re.D u i n ty 're-
fr ed imen ts we re se rved a n d ng oo d
Soc ial ti me enjo y ed af te r the
meeting.
dr~ils~uf ~ ~C~SERVICE TR 'ST
SHARES.
--.-{a4,¢» 4|»uu..¢>..,..}--.
ummm & MEHHENS
gzll Estate lnsunnce
Securities "
PILOT BUILDING ~
¢un knd m»"|s lawn ] uhnld|p;;;v~°°°r,'é 'Nunn ~
BAYERASPIRIN
"'is' é iays SAFE
Address
DANCE
AT /
King's
l f a v i l i o n
Mike North of Blair on
,Highway No. 5
1 v. . - f _$
Beware of lm lfations
ENUINE Ba Alvirih.u.gud docton presglbe and million
ol men have proven safe f°q'"°,;
can e midcntiied by the :mme Bayefyan'
the word genuine u above.
Genuine Bayer Aspirin is de and
sure: always the same. lc M the
unqullmed endonemznt of phyd-
duu a nd dru ' u evsy when. Itdouxr: d¢p,,,,K5,'; hart. No wmlul
dw-ehecu follow in une.
"rf Aspirin is the univad anti-
dote or pains of All kinds.
H m m .N 'tin" " q w ,es N§ \'l» ,a
,SoreThmat Lumbago
Rheumninm Toothache
_A l p i r i n i n t h e ~ o f b a y u
- / »`
Ba\|er13o\e'<.$|\s§>\'f§<v~
\g g i 9 ,
s '/ ~ /
¢ v
Sat., Febr. 7th
GOOD FLOOR GOOD music
GOOD ORDER
MUSIC BY
Ginger Blau
of' Omaha
|-sulll-IF lllllllly El-llu UI.BIIIIIIFUUE n r n T u u d ale rp rile o ee sf. making'M n .Rachel McDonald and m n drove over om Saturday and whilé
n r n n g e n u e l r f a m l l1 ¢ | A l la n , Mr . a n d Mn . . la c k § g l ? o g -I-'rank transac ted some business at
...\.:.\.A L . .\____15.1.an ¢ »- -- --- -
anwlucnLnry wlu nnve FED.ZU aid, Mr and MIB Chauncey WrightListings will appear in next weel¢'s|
Enterprise.
Mm Philip 0"FIanlon took Missg
Mildred McGill, Mrs. D. v. Masser
:md Hrs.L. C.Klopp 'oo Omaha'Emturday when all attended the
Qnlaha College Club bridge lunch-
eon at the Paxton hotel where
mom than a hundred college wom~
am enjoyed a .plegsanisoelal af:-
ernoon..Word from Mrs 0rlo J one so f
of Blair; Mr. and Mrs. Leslie An-dersen ol'.;0maha,Mr.and Mrs.
Fred Olsen of Herman, were Sun!
day evening d'n~r~r guests at the
Ed Olsen home, near Herman.
Mr.and Mrs.Henry Boll and
Mr.and Mrs. John J.Beters of
Scribner, were guests at the FredSoll home last Friday.
L. Gmnhn. v=P2i1 of"I'uesdey, car-
riednqticea _of Jmarriaggel _¢.snew-d mme Met°el"MaynnrEl 1scorfze , ri m. &az¢» um a he lbf emi - 'and Esperita Reyes of
the court house, Mrs. Brown vis
ited at the John A. Rhoadea hom- .
Mr.and Mrs. Joe Lazure of
Sunnyside entertained on Sunday
at a fine goose dinner for th.:
Enterprise editor and wife and
Mayor J- A. Landis and wife of
Ft; Calhoun.The day was a very
pleasant one at this hospitabh
home.
R.II. Rasmussen, who is located
over the Farmers State Bank,ie-w n t i n g m s u m n e e a n d b y m e a n s o f
s l l \ | * | \ r n a a : » \ \ n |». . ¢ . - . I . . . . . . . . __! . . ..r n u twill nniieryo an operntinn forgall'0mnha, and- Carrie Maynard 21,
bladder trouble n at the Bell'of Blair and Simon Oontreraz also
Memorial hoepiw t Kxnsns City of 0maha Both,.young women areKx=.1n.sa.s. Her mother, Mrs. Minerva the dmghters of Mrs. Ora May-
c a m r f th'o ls cxtv ls wilh her nard of this clty.Their father.
.. y-w=»=|un» unru runmng m rmEnherprise, in notifying his friends
of .this fact.Sir. Rasmussen i :
well known in Wiuahingtdn count;
and needs no introduction.
.
THE HACK SAW
vobums: 5 Blair, Nebraska, February s, nest NU ~an as
A man is authority
for the s u wm m
that therre workingnew on a x'6o\-pmol
airplane.I !they
figure que out, it'll
be the only lool-
proof machine we
know.myt.hlng about
A lady mme imaour More last Satur-
day night and wld
us the "Glow Maid"
Range in our win-
dow was the mos!
wondedll R a n g e
she had ever seen,
and we agreed with
her.
an old-timer in tho
westem part of thestat?tells us that
one year the grain
was so low the
words - "Nb more,
thank you!"
Be sum you a n
right.but before
you go ahead lt'|
ufa m e o nnl t t he
wife about lt.
Peacefully sleeplnnz
In Jonathan Placid
H e sHr¥*¢d h i s
throat_ Wllh/carbollc acid
One thing we wouldlike to know ls why
the sole of a sled is
called n. mnner when
all lt does ll slide.
We don't know wha
ther w believe that
or not.
Commencing nextMondaytherewill
be a Rmdlo Prvgpain
featuring the "Glow
Mnid" Globe Rmsv-
It wi ll b é " 2 t h e
WOW nnd don h i ]
to tune in ns there
will be something
real interesting.
The reducing class
will be lntereswd in
the newest reducing
method.It consists
of saying just four
|O l
li f e d o y o u spe nd
ta lld n g t o people
ab ou t oth er peo ple?
He a te r s i n stoc k.
PETEHSENHAHIIWAHE
down on théir kn~es Blair- Nebruka including The ~Glow
lo renhf the kernels.Boy und Ray Boy.
ll
daughter,Later ne s states that ,deceased a dozenyeus nav. work
she has had the operation and is ed in several of Blair'a print shops
progresdngnicely.|for.a number of years.
`Mr. and Mrs.W. J. Sas enter,Mrs. R. E. Fairchild, of Omaha
tained a number of friends at u
seven o'clock chicken dinner last
Tuesday evening, followed by pin-
ochle which was greatly enjoyed
by all.There were five tahlela:
added scores shoving Mrs. C..Hansen and Dr.R. J.Murdoch
high and Mrs.Oscar Gilbeztsox:
and John A. Rhoades,low.These
were given suitable prizes.
Mr.and Mrs.Mark Swihan and
Mr.:md Mrs.John Hamer of
Wayne county drove down to seea relative 'in an Omaha hospital
and stopped at the Joe Lazurc
home Tuesday where they were
over night guests.Mr. and Mrs.
G. A. Rathmann of this dty were
invited out w the Lazure home for
dinner Tuesday evening and to
visit with the Wayne folks who
left Wednesday on their homeward
vdtes The Enterprise that she ia
home again altar a year's stay at
the Kearney hospital and is feel-
ing very well and happy.The
Fairchilds formerly lived in Ken~
aard when Mrs.Fairchild wal.
taken ill with tuberculosis andwas
ordered w the hospital.She ask;
to have the family Enterprise sentto her Omaha address.We are
glad to know that Mrs. Fairchildis back to nonnal health again.I
Mr. and Mrs. F. W. Arndt were
in Lincoln last week_ lor several
dayi attending the Nebraska
Hardware Association.Mr. Amd!who ia one of the pioneer hard~
ware men of the state. has always
taken an active interest 'in tha
state nmeting.On this occasion
he wan elected vice-preaident of
the Nebraska Hardware Insurance
mr. and Mrs. J. E. Woods amLloyd Woods and family of Wal
nut, iowa were guena at the homcof their daughter and sister, Mrs
H. H. Brown and family last Mon
day.Mrs..Woods,Mrs.Browu'.
mother,remained fo r a longer
vlait.
Mies Alta Nelson, worthy mat
ron of McKinley chapter and L
number at her officers,Grac.
Ballard, Mrs. Oscar Hnpldns, Mr:
Ross Deets and Mrs. Velma Ham
mer drove to Omaha last Thurs
day evening and attended install
ation of offiars ol Vesta. chapte
at the Masonic Temple there.
Mr. and Mrs. Joe Verplanck o{
Armarillo, Texas who are benvi.
iting at the Elzy King home, wer.
guests at the Freeman Tucker
home last Sunday evening to seDr. and M n .M.E.Lawson o
Rockport,Mo., who were at th;
parental Tucker home for u fe\.
days.
n
II
M
1*journey..Board and was re-elected as a Mrs.D.Z.DL and Mrs.Carson Hunt of member of the board of dirgctgra lfuesday from Murnmzrt returned
a__wee[¢'s visit with
I.a.m.\-nie, Wyo. drove in Che latter
put o f la s t week to Omaha on
businenx and made s brief visit on
Mrs.Hunt's father, Hugh Steav-
enaen and her sister, Miss Elolne.
They called on her aunt, Mrs. Joe
Lazure and Mr. Lazure on the re~
tum trip and were dinner guestsSunday at the home of her bro»
ther.Wm. Steavensen md wife
who.live neg: Fontanelle.They
lf-~"Srnday afternoon for Lar-
amie.Mm. Hunt i s known to |
n'\1'br of Blair and 'Washington
¢"\!"1!v peoille ns Miss Amy Stes-
Q/mev-r o£»0m.shm»¢ad»he\~!fiendS
at U19 scare nsraware Assoaaunn
The L. S. U. of we Congrega-
tional church met with Mrs. Inn
Lotta last Tuesday afternoon.
Mrs.Lotta was assisted in the
serving of light refreshments by
Mrs. A. F. Newell and Mrs. Sherry
Moore.A prognm consisti:1g of
nn interesting article on Negro
Schools in the South, was road by
Mrs. D. Q. Van Deusen.Mrs. D.Qi Messe:-gav3e two negro read-
ings which were much enjoyed.
Mrs. A. F. Newell had charge of
the devotional service.There wu
a .guad..,repnmnta¢i|m.of .the
ner uaugnter,Gretchen,who ix-anendlng school at Lake Forest
near Chicago.Miss Gretchen had
"fe w dly l ucstion from herschool duties and she and her mo-
ther Hlioyed Chlf'-830.shopping
and takin! in the nights.
Hrs. Mina Schmidt of this city
was a guelt of honor at the birth~
day party of Mrs. Wm.Hudson
who resides south of Blnir, on lu!
Thursday,a s Mm s a mi a r mu
had a birthdly on that date.A
very line dinner Prepared and
served by Mia: Ads Harrison w|.s
61041904-lI¥~I|L-&nd»s.vory Pleas-
will be glad to hear of 'her again._
Bllir. Nebruh. February 6, 1381
TI-IE KENNARD N E WS
Mr. and Mm. Arthur Jensen Ind
family, Mr. and Mn. Lloyd Jacobs
and family spent Saturday eveningEttheparental,Henry Jansen
ome.The Plains
- w ":a"T :I
A firewall party was given forMr. md Mrs. Fred Petersen andfamily on Sunday.A lagge num-
U h | r | .
" Y o u r f a t h e r u n d m o t h e r a r e
w a i l i n g f o r y o u , "s h e s a i d ." G o ,
a n d I m v e m e h e r e .I p r e f e t o
'w a i l f u r : h e r e z u m o f y o u r I n d i a n
|I I
I.
moo at the home of her parents, Chevrolet coupe.Minn and Mrs.Alfred Svogerson,Herman Retzloff was x bmirwii
by inviting in thirteen of her mailer in Renard Wednesday.
°'uma.Games and music :rude a Mr.and Mrs.~~ " "'''
that have been :turd above BerryB1-vs. for the put yur md alulf.
Mr. and Mn. Fldrchild will go Whousekeeping in Benson.Mr. md Mn.Clyde E. _Rosen-
Sui hai tained back Harough For-
bidden vdley w me Huhnwk coun-try.Thdr own hops wal to lwhagwenw\r¢out of the path of
muse l lrlcd lo klll you!"ll:~morn]away from her towhere Heben and Jucherem und
me slmplemludvd Randal ily on
lne lrruund.This time It vu lnsldlot'|coat ne look.n flue contmade by the ldlo!'| mother.Theboy had loved hlrdl and llowerl.and on the lapel of (M colt wu|
|faded derenlnm bloom.Jeenulook lx ol! and tucked n betweenthe deed lnd°a Bunn.Then he wen: Dickandsaid,"We had
After lhnt he addéd.
but l must Ka to my
lnlher llrsl."_He sxnlzuvrffal ht
to ToluenebtttlrIG."
"I am lorry.
motner and
~ '1'?¥:5'?'f
ward Ill ~m2»-nl »..$'I 325
My eg o e wen .unely an nm nm u-lmeurle. andthere sho would dnd mean.: to beum to her frleadl ln Quebec. He
would dren Join Dlakxu zo nxhz
the Bngllsh.The lmporunt thingns xn reach l.\mnn'n tonlghl. lrha
lndlnnl vrnulrl not go neu' "fe-t a l.h¢'!helm-ea all :band nd
plaeu to he lghahlled by ghostsand erll xplrlle.It the! ltnmhledupou1:hy accldenr.they would
lm awey as quickly u possible.
He sull held her hand el dm-k~ness gathered closer.In lhls
glooin she whlspered:"Does your nrm hurt, Jeemsl"
l
ner or xnenda llld relatives nr.-1widen.' m y v m h a v e f o r w i
new home at Spiker by the firstof March.Mr. and Mrs. Wm. Voss undfamilyandMr. und Mrs OttoVoss and family visited at theAllred Svogerson home near Ken<f r e - ~nl
a u y eve lu steat the Wm. v°.H.°m'§'°$1,'i"'nr.
and Mrs. Wm. Thielloldt and chil-
dren from Winlide, Mr. and Mrs.
Otto Voss and family and Mr. md
Mn. Ben Voss and family.
Edna,Chtherine Ind Dorothy
:Voss Lillian and Mane Kahnk ab
tended n xhnwnr in hmm. ,.¢ nn..
haum snd mtl ~ v i x i l d at
H '-h i £"`f' i ° n i f m 5 Lincoln.
wan a Keunard business aller on
Mrs.nm French was called out
in Charlie Reeh'n Tlzumdn night
t o c u e f e r Mrs.R e e . h w o w u
threatened with pneurnonla.Mrs.
Reeh is much better at this writing
I-'red Kramer of Saint Edwardsand hsli e *R of Benson, vis-ited at Homer axd's Sunday.A shower was giveilat the Hans
Jorgensen home last Sunday nfl.-ernoon in honor qf Miss Frelda
Rasenhaum whenvzxll p a n flu;-
\Mr. and Mn. Hury Swansonand lamilz visited Sunday sher-noon nt e Nels Swanson home.Elaine Petersen spent Fridxy
and Saturday nights at the Lillard
Jensen home.
Mr.and Mrs.Soren Wolsmnnn
md children yvere Sunday dinner
gueeu at Gm: Chrlrlo!fe\~son's.
Mr. and Mn. Albert Nelson and
family and Mr. and M m Alfred
Svogerson and Chdstine helped
Jay Prader celebrate his birth nn-
g m w Monday evening,Jan.
Mr. and Mn. Huis Hansen vit-|iled at the George Nelson home¢s.._,--__ -n_._-__
- - - »-----W .. ...M ...nw mls.Svosemon seryed a lunch consistf
ing of sandwiches,pickles,cake
and lee creun.All spent an en-§ya.hle time and departed wishing
Mrlsldgyhiatine many '°f'~ happy
Little Brice Mehrens,son o l
~"1"f~=~1 ~
a s tAnsel Toft noni. as wee at the
dhi r.and Mrs. Christoffer An-
ersen and Walter vidted at theg=gg;=;_-1; home, near Decatur
M§ '.andMrs .P l F l ` hfamilyof 0mahauMr.el:n¢lr§;:_
u._...u l w n a m e n I n u m n e l ua n d r e l a t i v e s a t n e l l h o m S a t u r -
d |evening.
r.and Mrs. Henry 'l'id¢\=\1-
Mr.and Mrs.Henry K n k p n d
iwa llez Kni spent Sundny eve-ning at thegans Braeseh home.
Mr. and.Mrs. Fred Jemem nnddaughlers and Mr. and Mn.HnlryJregensenand son of 0mahn,r|>ent
Sunday at tb: Ifhris Sands home.Mr. and Mrs. John Headley :mfIlllrs. Kate Brunton of Valley, werecallingonfriendshere ~.Fridny
d nmg,
In and Mm. B. A. Goftach en-
tertained a number of Lruends me
.. . |. . »: . .. . .
\
c o u s i n ,P u l l T n c h o .a f u r 5_°===o l d e r m m J o e m s , c o n t r l ve s t o m ut h e p n r c u l a w a y .. l o o m s r e n n u t h »g e y o n .gags!a g u e k u f a u l b u t ua-|ronreur m n ulppeu :u m woume-u |"Nm 1 h ad f nr gu tlen " _"hnfnrn hlst &»\e14.Thanh w a l an - ; _J _1~1 alrac k _1""" "aa"';¢"m"':i'° `"H"5i"|"""' "|f"" an ""'°"3wmaereen:er washome Saturday afternoon.~ m hiiffnmm,
'.,'='»2'*ezz-_'!'_':=3s§ Eff" at }!=°,u» be meeeived -mv b==
y n p e g ,Q g | , | | | | | ; | y U l l u f l n U U n »s a u n a . :v c l l a c l l g n q I l m l l y o f B l i l i l 'a c l n u v t a » J ¢ l \ l . l I U I l y ! \ ( l 3 l I . l 1 l g .
g e d w h i c h n d m w N i e l s e n o f W o o d ,S .D .a n d M r .a n d M r s .H a n s J e n s e n o f G e o r g e R a m g r p a i d a
T h e b r i d e v x s l t e d a t t h e J .w .N i e l s e n h o m e O m a h a w v r e S u n d a y s u p p e r e t 1 - ' x s l t a t t h e o ..L l e s c h e h o
n u t i f u l g s 1 a `_ w e I f 3 u r . .. . ... . . .~a t t h e C ' h ~ i s t i a n A n d e r s e n h § ` $ §5 S u l i n d a y .._
l l ! ! b r 0 n l n l t h a n v l f v l u l l n r n n v .
C HA P TE R IV -- Next Mg . h a mtn l i n x h e wa l wr on g ln n w l ln .lnf ore Tolnette.f m to her hornutoo l h r his apo o en.Ho beanlrd amo To nte ur rc er to htm as tn" l t t l l Engllnh beast,"but make»
his apologies and foes homo,laylu g nothi ng o r wh at he has twelheard.llealhlth takes his depar ture.The oatc urs so to Quebetw h e n Tolnette in to be educatednrduringtrhiclAfterfour:fe I .Jeeml nrac tlc ally rerhen ngnnhamt
lehe lik e a splinter twisting In his
head,and as n h l followed hi m,Tola etto could seo the atm- t ol'
hor u nmslsted News with th e ir on
gun barrel.Fo r sho did follo w,
out o f the anmke f u me !in to the
clearer air of the mead ows and
ller oss the m tn the worn path that
led to the Indian tr oll an d thehottie at Cqhlt-rine Bullla.
nuts )UUl ltu uuuau A l\_fou?""
"I had forgotten. that, too."
Something touched a l l shot
lightly .Ile c o u ld n o t te ll wh
was,fo r they were la a pot
darkness.But whatever I t n
have been,a falling leaf,a 1
even shadow I ts e lf - i t filled
wlth a stransze exaltatlon.Ot
the wte tk of a wor ld oblltex
mach]
alder neilry wersemsnn name werean 1|and Mrs.Herman Muelleruof 'family and Mr.and Mrs.aight Wesemann and family fromtwig.Benson.him Sunday dmner guests at
lt of August Kahnk home were Mr'ated |§Irs._Fpgd Martens,Henrf
Mr.will us useful gifts.and Mrs.Harry WudellDick Wendell visiwd at the .1
mr.ann mns.Ame n rem-son A number of friends and mlnandsonand fazml of Irvmgtan vxsnted at W A H I N hxe theréd mt the Jens Hone.''' '~-" s ' rohn Blacolthe A] i mnbe rz home Sundnv S G T O N N E W S Ihome 'f.§`,¢ Snmfdnv »=H->--~»- fm-
near
the
an d
etta,
mr n ,
h o me Mo nd ay af te r no on .
A g r o u p o f fri en ds su r p ns e d
Mr .a n d Mr s . Ha r o l d L a u tr u p la s t
Saturd ay n i g h t wh e n th ey Calfff
i n to he lp th e m c elebrate th e n
si xth we dd i n g a n n ive r sa r y .
*I
~M r s .i i i l l W u l b e m a n d M r .a n d M r s .A l B r o d e g a a r d o f
f m i 1 }s p e n t W e d n e s d a y e v e n i n g O m a h a ,s p e n t t h e w e e k - e n d a t t h e
a t t h e H e n r y W u l b e r n h o m e .F r i d n l u n g b l u r t h h o m e ....
T h e D o r c a s S e w i n g C l u b w i l l m e r r o m t h i s v l c l m t y a t »
[ n e a t F e b .1 - i t h w i t h M i s s E m m a t h f a r e w e l l p a r t y a t t h e
.- .- - - -- " ;s s n s y s s a v v m l A U !a f m s o e l i a n e o u s s h o w e r m h o n o r o f
M a s s J o r g e n a H o i e r .
Mr .an d Mr.=.Ha n s Bmes c h a nd
da ug hter ,E lme r Ni e ls e n a n d E r i c
Kn ud se n we re c a lli n g o n A - C :
Sunrls Ins!Fri|Inu naunnfnnrthe Tonleurl rvmurn.War betweenBrltslnandFranconaman,lnrlFrenc h settlers hasten to i n D i nkno, Frenc h commander.onrl and.Items remain st home.Abn nl. omau o n n hu n ti ng tri p . J e o mo n e r.|......... .. A|¢¢¢m¢ his hnmn In Amman
"1n@y re "0\\f|mer a,"namJeems,an d/ pn ln te d,Sn vlk in z to
Od d mo re mf: to her.
H e look w e hatc het fr o m h u
_t u and cap-led i t in h l l hand.
in o scourge nf' hornor he in
sou!beside hla o wn to light
Twic e iq the ne xt hour
halted and g m e a gr o wl 1|
warned o f thinner ln th e
A .. lh-mm Ivnlfnr and li*¢n| ...I 1:»1|-x"';.,,: ;a;;:;..g ~ 'iiZ"BT"'§;" F35nur-|Mr. and Mrs. Leland Ward and|Mn¢zen as hostess.Mrs. Albert N
r r c n e n h o r n S d r - ~- -- - - --- - :~ " - - " 6. e \§¥1 3 3 |M r s .G l o n d e n m n g w a s o n t h e
~~ 18 ~2 I.|l*\\. ¢l{l*|r " a i 122|fnnnnl A n u .l.....t -....|una | '"' nun """'" o x *"°"'°m chihlren of Omaha visited relahlchl»Ir.and. Mrs.Ben Vos nd rair. Ifarmly attended nth!! fn:ou.¢3\ ~ "".sf"=;?_fff'1*:e-"'§'::f:=d»_|Mr. and "weefamily, Mr. and Mrs. Fred Nclscm
and family and Ted Nelson visited
at the P. J. Nelson home Sunday
afternoon. Their deter, Miss HuldnNelsonof Michigan,is visiting
the home folks.
Mr.and Mrs.Soren Wolsmanr
and family visited at the Christian
Andersen home Friday evening.
Mr.and Mrs.John Vogt,Jr.
and family attended a farewell
part.at the Fred Petersen homeSnmihy afbemoon. They willmave
io the John Vogt, Jr. farm, wegt
ol Herman, the first of March.
Mr.and Mrs. Bob Mortensen
were dinner guests at the AlbertNelson home lan Monday.J. W. Nielsen and Andrew Niel-
sen drove to Irvington last Wed-
nesday to visit their sister,Mr.J. F. Hiltahidel and family.Mr. and Mrs. John Frazier and
Mr. and Mrs. Claude Englert and
Louise are spending a few daysvisiting relatives at Nevada, Mo.
Mr. and Mrs.Soren Wolsmann
and family waited at the Nels
Christensen home Saturday eve-
nh. Erma Nielsen visited Min*
Bumette Matz last Sunday after-
noon.Mr.and Mrs.Chriswffer An-
dersen and family spent Sunday
..,,,..
/ '
Prices
Are Dow n
So is Harness Oiling
W e L O W
C h a r g e ~$ 5 ~
J a c k D e m p s e y
Kennard ---~-Nebraska
home.Christine Svogelfaon celebrated ---.
GOODYEAR
LEADS
You want to buy THE
Best Tire Bargain for
the MONEY.
Examine The NE W
GOODYEAR P AT H -
FINDER and consider
their NEW PRICES.
ROSENBAUM
SERVICE STA 'l`loN
Kennurd,Nebraska '
GET READY
~23
~:L
,_»..,.~~;=
~u.. ~ f.'~42
IW;u:1~.w. ..
5 ~
gli °#Q..,1.am f ; ~
1 ,`;>§f"
~¢4 .~,_. u
~:,=.¢2?-:,§rf;4 /
"Nerveé
D o t h e y h a r a s s y o u by
da y a nd k e e p you
awa ke at ni ght?
Don't neglect them They'Zl
ruin your charm and beauty.
nliambe your em, interfere
with your hx u i mu md noch]
success.When ¥on'ra na ma n ukeDr.l w a Nefvlue.Ita the§ ~ ° " § " ° f -o f , ; , m? : | d u l
m e con-nnla nt om upudnlgplor peo-
ph in your condition.
Dr. Miles'Netvine l l naw
mule in two farms-Llquld lm!
Ellervexeent Tablet Bod:a nthe uma thenpeutically.
N§§¢f§E
l l v u I -u u | \ ¢ n \ . u u ¢ » - » . . -_ . _- --
CHA PTER V -- Ha B hd ! hi s fllh etand mother dead and the bonu unobarn blazing.A hntchat., ot Enfllat.ma lt. le ft. on the scene. eonv hlf trM m the llnupxhter l l the wo rk oll l o h n i k Indians,En g lllh ll li e l'rho mound or atunllro u c o m e tohtmfromtheTontuur»»;r»-»»='=r l a tta n d a t d u m. te a r ln l or o n e.lla mutans there.Tonteur and |1||
'rhey entered th e g r ea te r su u o e u
of the B i g forest,and 0 6 6 .wh ohadtraveledbetweenthem.
dropped book to 'I'olnetto'|side
an d th r u st h i s muz z le : p in o t h e r
hand."
She d id n ot sn atc h It a way from
him now.
Th e r m m e to th e n1on|an d
.Teoma strained his ey e: to see and
his ears to heor- -and onc e more.
when they stopped to listen,he
fnlt the gentle touc h a g a ln n his
shoulder.The y struc k a dee r ru n a nd f ol
lo we d i t i n to a pla in be twe en two
li ne s of h i lls wh er e a d e va f tttlu g
g ; _ n ; , ; ~Fr e d r e f o r m home' on
Mr.an d M r s W m .Htln sen a n d
fa mi ly a n d Lo u i e K a h n k vi s i te d a t
th e A u g u s t K a h n k h o me Wednes-
da y even in g.
Leo ra W 1 -ic h, Ma rjo ri e a nd Ha r-
I"'FY li u h r spe nt th e we e k e n d a t
I I I C t : l g u u l K r a u s e p u p u s a t m
t h e i r t e a c h e r ,M i s s M a d g e G a i n e s
e n j o y e d a p i c n i c i n t h e c o u n t r y
a f t e r s c h o o l l a s t T u e s d a y e v e n i n g .
M r s .E .P .B o o h e r e n t e r t a i n e d
a t a n after no on q u i lti n g a t her
h o me la s t Fr id ay .H e r g'uest=
we r e Me sd ames S a m Ha l l,E a r l
Janlrinu I I (1 lllnnn l|"|\nav \.l.fvhv|»\'|f i r i i d l i i r a dead.A c h at Iou n mJ a n a .Bellovln hlra l n enemy.Tolnotto, from a ldlnl Plans In thn-m l l l , h u a n d on hlm.Ho ruaherto use mlll. when tho xlrl announcerhlm an un Engllrh nmn and Lr ln lr.a m hlm.falntln bd or a lh o canc a rr y o ut ha r a n ln ._.a na m o n i n ou t a li ¢ I p 5 ;hand
th o uxh she fe ll h a n a lf n vly ln g .
He W u n o lo ng er y o u th .B o wa s
n o t ~ . .J eems B nlnln.
B n ! h l| v o lc e wa s th e n u m.
"I a m s orr y , Toln etta."Jeema amrc ely kn ew h a spoke
th e words.They r a n :buck
J w m a fungal that To l n e tu v u
behind hlm.H a walked l t r l l i h t
d o wn l i k e a m l . t h l n g b a ! - a n d
th e g lr l ltvn n ed a n d stood d o n l .
a la r ln |a t the plac e w h e n h l l
ho me lh mllf l ha ve been,a c ry
wr ln glug llaelf a t la n " n - o m he r
ll p aJ e e ml did not hear.H a u w
nothlng bu t th e d u m p o r roaa
tmahea an d the plac e who re hla
mother lay .He we n t to h er llr at,
ohllvlous ol'other presenc e, unc on-
ac loux ot th e mm, nt the ruins atlll
mnunldnrlnu hln . m u nn ln ln p ur e n nu pa s se d wma y eu nHe ra _ th ey traveled through a
y oung growth o f haa hea and traearenc hlng lc arcely abo ve their
h e a d & wlm th e llg h t o f th e n a r a
mlm; o n th l e m.ln a tlrr ed a n ot!
radlanc e In nln ette' | s moo th ha lr
and lllumln ed Jeems'tac o un ti l
th e wou nds ma de hy her hands
.were p llln ly ._revealed.Th ey
c llmbed the northe rnmost hlll after
a u ma a nd n t the top o f lt nn pp ed
again to ms t.J eems, llkn odd stood te nse and
llstenln g. s earc hin g th e alnmbr oul
°h';j;*»~=e=~
r a W ri c h,Ma r j o d e .Ha l han d . la c k K uh r vi si te d a t th e A J ; -
us t K a hn k ho me S u nd a y a f te r no o n
Mr s .H .C.K u h r a t te n d e d th e
l.a¢lles'A i d a t th e C r o we l l H o me
i n B la i r Th u r s d a af te mo o n .M r .an d Mr s . § e n r y K n i - z p a n d
lllr . a n d Mm. Ot to V o s s a n d f a m-
lly atte nd ed a bi ri hd ny a m y a t
th e Charles Vo ss h o me one day
la s t we e k .
Mr s .F r e d K u n n e mn n c e le br a vle d he r bi r th d a y Th u r s d u v b v en-
............. ... V. ........, ......., .lr n L a m b ,E l v i r a Sp ra ke r,L .E.
W a r d ,E .0 .Fai rc hi ld a n d Mi s :
E va Mi lle r .
Gi f f o r d F r : n c h h a s mo ve d i n n
th e L u th e r a n parso nage w h i c h w
been vac ant,f o r seve ral rnuntha.
Th e house he h a s b e e n oc c upy ing
wa s so ld to H. C . E d wa r d s a n d h e
wi ll move i n to i t s oo n .
Mr s .M a r y L a u tr u p an d fam ily
h a ve mo ve d i n to th e Mathie sen
pro pe rty .M r .an d Mr s .Geo rge I-ledelund
an d J e a n ette . Mr .an d M m .Chau:
l
through the yearn u l !n ghost
n a d c ome to life wh o m memory
they had Enroll ou t ot their hearts
n lon ; time ag o.'W hat are y ou d oing here? " she
degpndefl..__.
. -v . u \ » ¢ . . ¢n u v u -u \ ¢ ; »¢ » .v n n v lmo r e wi th th e f a ln t me d sp a r k o t
Inc redullty .Hu t she was dead.
H e new her wi th clearer eyes.
th ou g h h e wa s s i c k wi th hu rt. Ha
kne lt bes ide h or c almly f or l little
while.He touc hed her fac e gentf
dautances of the wilderness which |terte§ni:1g a nuinbar oi' fr nrfs :d Re <e»w=hH黧-He§@§"1»f"'ii¥
lay about them.Ho cnutht all <1elatwea and ra H. C. Blaco last Thurs-
movement and nlil daorirgd, _fggdgl ggf f Mrs.d IW Rasmussen day evening.
ecuon of the wn .e n an c i ren gn emy Petersen _h Mm 1; lmL . ,Of the shadows,the almost 'and son of Centrd Cit v ted *Mrs C nstina er spen
,Y.ISI a. Thumd ftem n t th homenoiselgs¥1l_§ttef_01' an owl: win!! |fhe Charles W1:ch home Saturdav. ..¢ sm. "'»'f,...?»..,..c.;°...z.f.... r*?.-:¢+.~.»»
She might have naked that some
question In those unimportant
y ear n when he ha d dar ed to vis it
Tonteur nmnnr wi th h i !foolishglftn.Why Wah he here?He
turn ed I n the d ired lon fro m wh ic h
n o had come and h d d out his
h a n d . n o t f o r h e r to tu e ,bu t an
n voic e.She unde rstood what his
harden had been.Te n n ?Such
I
I1
ly wlth his hand.and then went
to h is futher.Odd tra iled at his
heels.to the stump held wa s n
shovel.Under his rnother'a b l ;
tme h e pla nned to dlg.
W hen he returned,his mother
was not alone.Tolnette was there,on the ground.wi th the English
woma n! h ead in her lop . Her e y esI \ | u » . e u ' \n h u l ' l u m e n s A n i l - n » ~ . » a t . l » . »
over tnelr ne xus.And then he n e w wh a t had
touc hed his sh ou ld er I n th e da rk
ness--Tolnelte's cheek o n s
ag a in s t i t fo r a mome n t a l lllhtly
ns It feather.
H e felt her trembling.W hen
she looked at mm,her ey e:
rested o u.the b rand of the mon te!barrel which lay in a red lrtrlpe
evening.'
.. ¢rn.E .C H U R C H .K E N N A R I )
Re g u la r servic es n e xt Sun daylmo r ni n g .
|Sunday:Sc hool. 10:00 A .M .
Pre ac hin g, 11 .0 0 A . M.
f Th e eve ni n g servic es wi ll close
v a n u n \ l L V b l l \ ; £ |r n l l u n c w . \ | | | | | 5 3 5 C I I '
s e n a t B l a i r .
Mr . a n d Mr s .A . J .F o wl e r a n d
da u g hte r dr o ve to Oma h a la s t F r i -
day to spend th e da y wi th M r .a n d Mr s .Ra y mo n d Di xo n a nd Mr . l
a n d Mr s . M. P . L a r s o n .I
Ru d olp h Fi c k o f Bla ir ,wa s 6 |
B u s i n e s s c a l l e r i n K e n n a r d T u e s - |
n v" " " " " " " " " " " " " " ' " " " ' " " " " " ' " 5 across his forehead.Th e stars 11.0 gi ve o p p or tu n i tv to g o to A r lmvml th in g s c o u ld n o t exlntln th e li ke denance was in them,some-seemed blgger and cleaner whe n f imr ton to atten d b-e me e ti n g oz
aftenh ent ni'the h o lo c n ln that .thing umm n a s po aa c mvo and at las t they c a me to th e ha lt mi le *Mr Howard , n egr o o ratozzma c o ns u me d zhem.Pride,defyim: gr ie f raised her c hin n l i m e §E:llef,¥1mf_,,f"ff,,_f,";f___Ei'1_'_I " ff l or abandoned road whic h ended in |rr l1 \ 1 __ _ _ _ , _,__,_,_,,,,_,,_
;»'. A : :3 A
L u n d h o me la s t W ednesday eve~
nin~i n h o m o f Mr . a n d Mr s . Ola GOODYEAR
LEADS
You want to buy THE
Best Tire Bargain for
the MONEY.
Examine The NE W
GOODYEAR P AT H -
FINDER and consider
their NEW PRICES.
ROSENBAUM
SERVICE STA 'l`loN
Kennurd,Nebraska '
Punuc
.SALE.
On the Retxllff farm located V: miles soulbgut of Wuh-
»\n \.
Mr.and M m CJ1Hntolfer An-
dersen and family visited at theq-=1=Linden home Fri dny a e-
g.
KENNARD RURAL
Jo'rrI§cs
Mr,and Mrs. Henry Arp,Sr.
were Tuesday visiwrs in the I-'ritz
Arp home.Arl Jeffers of Council BluffswasaTuesdaydinnerguestofFrank Gasser and family.Mr. and Mrs. Louie Gottsch andfamily were Tuesday evening vls~
1 ;s |1 -ried.The e ven in g was sp en t p la y a
i n g ga me s a n d g i vi n g advic e to
th e bd d e .Th e v o w s c ouple re-
c e ived man y us ef ul g if ts .
GET READY
To PAINT...
1931 Paint Prices
Ar e Cut
1 0%to 2 0 %
LINSEED OIL is the CHEAP-
Frank and Herman Gaaser
spent Wednesday in Omaha.'
Jenn Christensen and children
vidted at the Orville Allison home
Tuesday awning n¢ Waterloo.
Mr.and hlrs.Louis Gorehamand fnmlly spent Thursday evo-ning at Frank Gansex-'s.Mx. Fred Lambrecht and chil-dren and Mr. and Mrs. Louis Gore~
ham and children were dinner
guests at the Frank Gasser hom:
Sunday.
Reinhart Guser xetumed homoSundayaim-noon from Wayne
county.Carl z mlme m and EdPetersen accompanied him home.
Mrs.Dora Sumner accompwed
the Kennud Aid Society to theCrowd] home Thursday aitemooMr.and Hrs.Wm.Hunt nn~daughter and Mm.Anna Carlsonvidted at the Wm.Cunningham
home Sunday.
NERVINE
7'uid
~Q
:""'9 ~~
.~ z ~ . . ;
..,..Q1
.. A
~.~» .-~>./M
15% gt ¢z";.,b » . Q~.
-51z"_ _ _~ ;;
"Nerveé
D o t h e y h a r a s s y o u by
da y a nd k e e p you
awa ke at ni ght?
Don't neglect them They'Zl
ruin your charm and beauty.
nliambe your em, interfere
with your hx u i mu md noch]
success.When ¥on'ra na ma n ukeDr.l w a Nefvlue.Ita the§ ~ ° " § " ° f -o f , ; , m? : | d u l
m e con-nnla nt om upudnlgplor peo-
ph in your condition.
Dr. Miles'Netvine l l naw
mule in two farms-Llquld lm!
Ellervexeent Tablet Bod:a nthe uma thenpeutically.
0
£Ii'E.'L'J.'?".Z'I..'°_E& 51359; | Ria;'f.?",.i'é2i'.n3;};"'iE.f"'i.1Z'EZFJZI !'2'.t""Z'..E""5£'1¥;. 'E 'E' .SEBI luis A u u w w w :
a v v l u l u m u :n u n g u r u g .A B U W u l r n
she c ame to :he plac e whic h J eemn
had prepared. she was llkn a white
angel wh o llntl appeared to gaze
f o r I momenr or two f u p o n thedead.
With a tool he had found, .Teams
had made n grave.I t wa s lh l llo w
an d made less u nbeautiful w u h ahed of golden grass.To ntc u r di d
no t : ff m u n lu i pp y u g h e la y u po n
ness.He r lmnnls were pressing
th e cold face o f the wo m l n she
had wanted to h ate , and s he c o n-
tinued to lo ok at J e en u.| o h ar d ,
so terribly .so underutuidlngtythat the se emed a lmost to be wnib
In g f or h i m to punish h e r wi th n
blo w.
'I'l1en she hon ed her need over
hls J nother.and the shining veilof her hair c overed death.
r u u u U U \ \ u w u | l . : u a : w u s u l u
wllic hed Tonteur and Pa ul Tac he
and a p rou d . lmle p rin c e! ! r ide to
the sale s e a n before.No w th eprincesswalkqaunsteadllya t his
nfde.She wen wh ite an d fragile
lu th e s tar lgh t,and her stron;-th
was gone.er d ress was tor n by
brush [and hrlnra,and the thin
soles of her shoes we re almost
worn fro m h er f eet. Sh_e on-uggled
w .B .Ros en ba um an d Fr ie da
dr ove to B i ai r F r id ay on bu s in e ss .
Se lma,wh o is atte ndi ng.h i g h
sc hool there,re tu rn ed w i th e m
to spend th e we ek q d wi th he r
para nts.H e m J e n s e n wa s a Bla i r b u s l
n e s # c a e r l a s t F r i d a y .
Mr . a n d Mr s .L e e W i c k wi te a n d
. . l » 2 I ¢ l ¢ . \ »A f A . . \ | ¢ . u u l A ] ' . | \4 n n n h l nll..J.ul: wp or ml neltl wal 420V-ered so.'"l'olnette could n o t see.
Sh e k n elt a n d pray e d, a nd . heme
d r e n bac k.feellng th at to kneel
wi th her,wi th the ma r k !o f hermood o n his fac e and b ody , would
b e u c r l le g e
Even now.wh en i t should have
kn o wn b ette r. th e mi ll whos! c ou
Iin uod to vrhlno and scream,and
suddenly il oc curred to .Teams that Il
" U n d e r t h e blg :ree he began to
s ¢`4 o o u o »
lt was lore a fternoo n when their
.left the valley , u sllll,:lu mb eri ng
hour when the son wsu about to
go to it! ea rly re st, le avi ng glo ws
and sunset pnlnlingrl behind th ot
mig ht ha ve been ma d e ' o t n r i m-
mi n g me tu la
"l"nlnnlf a'n hand In-In hu.»_».l ..-
nr ave ly on ma y e nter e d too c i al-Ing.wi th the ruin of the house
ahead o f them.Bo th were so
tired ln soul and body th at their
minds Seized upon this end ol'
their journey as a rellet fr omlongeroup po nlng the burdens or
the flesh.I n a wax.i t wa s li ke
c oming to u home whi c h the y h ad
forgotten.I-'or this was Losoazfs.
o nlac e lllled wi th me mo ri al of
\ . | u : u u : | |U 1 r L : u | | n u u | .n c u p p t l l b uf e w h o u r s a t t h e A . .J .F o w l e l
'h ome las t Su n da y af ter no on .
Th e i n f a n t s o n o f Mr . a n d M r s'F ra n c i s Funey ha s been i ll the
pa st we ek .
Mr s .Me r t o n W o r d o f Oma h a
wa s vi s i ti n g fri en ds here 0:1 lnsi
'ThursdayM r .a n d M g s .N e l s N e l s e n o l
| f ! » n u l n n \ ; : : l f n . |n v a r q | | | | A Q \ y ~! !e o u l d n o t h a 1 e . b e l n t h a t w a y
y u t e r d n y w h e n T o n t e u g w a l l l l v e .
A d e v i l m u s t h a v e c o m e t o a b i d e
n r t h e t o p o f t h e m l l l l
H a u n i t e d .s c a n n i n g t h e n g ; 1 .
m u s t h a tn w e a l e l h l n n l n g o r t h e i r
¢ v; u » \ \ \ . i l u n u u u l )ul ¢||:\:|.!.lB I l lt h e y w e n t .
T h e y w e r e l i k e n y o u n g m a e n d
g o d d e s s r e a d y t o f a c e t h e h a z a r d s
o f a s a v a g e w o r l d w i t h n s t r e n g t h
w r o u g h t o u t o f f i r e .T h a a l c k n e u
h i d l e f t J e e m a .H l s w n n n d n d a r m
hope and triumph and blttemaso u t o l 'w h i c h l t b u l l !a w e l c o m e
f o r t h e m e v e n i n l u l o n e l l n a n .
'1 'o l n e t t e 'a l i p s a l m o s t s m i l e d ,a s
I t s h e s a w M a d a m e L e a n n a t t h e
t h r e s h o l d o f t h e d o o r c a l l i n g t o
\ . r " ° ' : ' " 'I r e l a t x v e s h e r e .
I
l v h v u u \ | l \ . l n. . | u \ . & | J
Mrs. Jim Reeh and sister. EdithFrench visited at Sarah Swiharvs
Sunday.
Mrs.1-Elmer Miller entertained
e n vn r u l n n l a i h va e f r n n l f I n v I n a fp m v n .u e n m n m pu a o u anddssthm!¢h\: J n n over In o w n
ilaekenod m n .Tolnette,bsslde
he r mlhor,msde him think or
fina l.lr seemed n lon g time b e
t a n l i e rose to fare hlm.She
v u ao!crrlnz-He r eyes were»)luo n m ln n countenance n l
gg- an marb le.The mn :hone on
and gave nn nneanhly rsdl-
a u c o to her hnlr.H e r beautyid d him s tr ic ke n jul! ss hll ow n
~\urIhlenau forced from hor a
n o o f n m e n wh e n he o n e o f!
h elcont borrowell lfronr one o¢_§hs
was cured for by tlnger: ni gentle
aa bla mothers had he m.B o t
tears csrelnlug hh Hesh from Tel-
netle'| dnrk lashe s had cond hisnhydcal pain.Wordn spoken in s
vnlee he had never heard h o m
her llps entrenu ng hls for|nven$
for yelrs of mlmnderstsndln;
were like the peace of tho day n~self about his heart.Ou t of r um
she had rolled hll soul to splndld
helghll ot courage and resolntlon
They valued hls mothefs |nr~
dens or no we n w h e n eholeo
h l m m .. . . . ........n-_. . . _ .. ,
her above the laughing vo l c a
o f men nnd wnmen.nlaova her
hlher's c heery greetlnsn to fr-lend:
snd neighbors.above th e m u m
sn mp ln g of he r ho r¢ e` s h oo k sn dthe vrr lns nt the an c tlone er.She
mlg h t have seen an d heard these
things bn!y e s le r a y ;n o w there
wa s s l e e p - I dark s u d u m m
: h o n o f |hou se. c r ic k ets rllnlns
lhe lr wln g a ln m e tangled n a n .
|jun gle growing w h e n before
th e m ha d b ee n a b r o ld a n d le ve l
green.sfnn were ehlldnen now. leelnx
supper last Fridsy night in honor
of her hnsba:\d'n birthday.
Sunday dinner guests of Mr,
an d Mr s .Cly d e E .Ro se nb au m
we r e Mr .an d Mrs . C h ar lle K e mp -
c k e o t L y o n s .an d Mr . a n d Mr s .
H e n r y Ke mp c k e ._
Mr s .Gn s K r o n b e r g alhe r tmne d
th e f o llo wi n g o n Sa tu r da y eve-
:nin i n ho n o r o f he r h u b n n d ' sbi r g ld a y :Mr . a n d Mr s .Fr ed A n -
drease n and c hildren,l l r .a n d H n .
Cly d e E . Ro s en ba u m an d c hi ldr en ,
Mr . a n d Mr s . C h ar le s K e mn c k e o f
D
u m m m i n l u u tp r n u ll U T I ! T N I - |in n - .B u t s h e d i d n o t ~ O n l y I
i h e mi i l wheel continu Rl vi r u -
h n :p l u m a n t h e l o o u a r m m l
a n Ilan 'hmrnn l|\Al»»sn-|..L_ 1
. . .' ¢ ¢ . | -n \ | C u v t l u l L l | ¢U . l | »| l l .I Uo v e r l l o w l n g w i t h r i p m l n g u s d a :
t h e y s k i r t e d t h e t u m l p I l d d w h e n
1 p u r p l e b r e a s t e d c r o p h r w a i t i n ;
f o r ¢ l \ | r I f f n l i u n .. - 1 . . -. . . . . . | . . . . . - . . .
th e g h a tu a l only children could
see th e n ,wide ey ed and |li ttlenfrnlda t ti n t,and r e t c o mf on ed
b r th e n e a me n o f th a t y e lte r d a v
Lyamjar. »ndMri."déii&§"'-ber and c hi ldr en of Gretnn, Dd vs-
sa ir on b er g o f Bla ir ,M r .an d
M P 1 FW-nd Frenc h an d nhilrlran.F '- , . . ,.......,. . . . n e u n p n e - |u i d h v o r l o l u B a h .l.n A plnc e
whe re frebh dlrt w u le n t te e d
b o u t we r e to o l s " lc d r u t e r d n r -
axeu and :n ovels end h ic kory pry -
ing poles en d th e h lg double-
blldb d grub hue whic h Bo p d b a h
had made ll To n te n r' | f o rg e .On
1 s tump pen ly du g f ro m me eu- ug
was on e of Hep elbnlfl elves ma de
o f b u f a corncnb wi th 1 ho llow
reed fo r a Item.
ln th e i r l lvn .T h e m n a n d t h e
er lc ke u and the r n n lln g g r a nen d tn e wlnd I n lhe tre es s ee me d
to llllen a nd move to th e c a ullo nn
tre ad ol thei r fee t.A m b h n ran
ah ea d o f them.An o wl new nf l
the mo r o f th e house.A bn:
dipped In l p l n l n an d c urves b e
fon e the ir ey es, I nd th orn s aug ht
play fully a t the lr sho e:an d
clothes.A n d :hey f e ll u m A
Th e e v e n i n g wa s s p e n t vi d t i n g md
lay ing c ards.At A lub e h o ur Mn .Rron her g se rve d A delic i ous lun c h.
Mr s . Ro b e r t A n d r e u e n u n d Mn .
H .AC.Bla c o drove mu B l d r Mo n -
d a to vi d t Mr s . C. B . Ha n s e n .Ku . a n d Mr s . Gm; K mn b e r g a n d
Twy la vi s i te d Mr . e n d d d r s . C ly d e
E . Ro s e n b a u m I n d h ln i l y a t th e i r
h o me i n th e c ou ntry S n n d n y a lt-
Aw x mauu lily t owa rd th e s ky, nd wh nu
Ja ms vu d o ne s h e ac c ompa n ie d
Nm back to the mill. Sho watchedhim lo for h ll b o w, w he n he u w
that the form he had Lhought was
Talnsttl nu :he vrlfe of Peter the
Y a n g c r .
Be mme b a c k md mo t h w h e r
: se co nd time Th e llnl :h a ha df h o k m with tha m a n n vm-».|
GET READY
'l`0 PAINT o 0 0
1931 Paint Prices
A Creut
1 0% to 20%
LINSEED OIL is the CHEAP-
EST it has been for years.
We handle the Famous Qual-ity PIT T SB URGH ru wrs
Remember the \-
Pittsburgh slogan ,§f»;"°
~~4»
Kennard, Nebraska
lu n n r o l l e n , a n d t b ; i s - r g : - d ~
' l la forehead was turnlng n dark
n a d mm c o lo r . Th e c lo th h e h a d
warmth crept through their blood,Jeemu #WDM and looktd about,md with lr n relaxation of nervu"2 Eh"°fF llmost tenuinl tor the ind .......-...»s......|_--°"K"i"Iz l n d i wFlhnivi l * ~. ¢ ? l .f.'1'i°.'l"' in
f v l m a about hla wounded arm
wal re d.Slc kna l a nd uuln w ereiu rd n g th d r w ay in to hla e ya .
"I nmat take you away," he sam.
*There la not llme to care for the
ellh lll.lf I-he r come haek-"
"They v m not harm you.":he- m e
Jeema made no annver hut
looked away over the Rlchdleu to
word Champlain and Dleakau.
' A n d they vrlll not harm your
hlher or your mother or anything
that belong:to the Bulalna.butwill reward them for their loyully
i n murder and outrage.l l unt
in n! t ru er '
sun Jee ma dia not answer. but
stood lllleulng for sound to come
our nf the dis tanc e.She a aw the ah-knees gathering
. i n h l l h e e a n d a v y a a , h u t | ' t y h e
h | . m \ u a a a d e a d l n h ¢ h . a a l a |
ihe r de sir e to llve . Sh a kne w wh enh e w o u ld la k e h ar .To h h h o m e
. - .plac e zen u n a a th e d b y th e
I llle r a .T n hla m m m "er... n n
o m m n u u r ml ! lo He p e lb a h . B u tthe adllnese warn ed h lm.L i k e a
friend n wa l wh llp er ln g the
a a c r e d u e u o f a n o th e r mm.H l l
eyes turned to th e lovely haadnearhll aho uld er.I :a m e m m t
f ° ' ~ ~ l ;ralsed h e r e m t o m e a
lull. an even with hla mother they
mm nn ( b u n a n d ee p a n d g en tle .' Th e y muat_ha ve c aught my
uh c le o u t th e r e ." h e a a la ,xn p m¢
hla vnlcu steady u n d . ¢ n l n | o v e r
u.e forest lopa o t Forbidden
valley."He eel tha alg ual hro for
ua a nd the n was kllled.l would
xo and ha d hlm, l- t lt were not foryou."'
~l wlll go wllh y o n, " an awen d
To lu e n eBu ! J e e ma tur n ed wee ! a nd d d
un ! lo ok b ac k at hle home or b| ~
tra y L he eh oklug In hla bre m. Ba
found hlmeelf talk ing to '.l'ol.ue4te
aa xr ane were th e c hlld o t un old
dny a, and he, changed Into e man.
were er p la ln ln l r h l n p .B e do-a e r l b e d f o r t h e n m u m e h o w t h e
- W q u - n u u m m .n e l !waasanc tuary .Regt.Peace.Th e :
se ns e d the se lh lnp wi th o ut : p ee rIng a a the y ap pmurh ed the bu lld-
' u | .Th e door wua open.Star-
lmn an ln ah ed I lk e the : olde n do w
fd c a n dla u n th e lloo r .They eu-
tered an d stood alle n!na I f I lete n ln g a n xlo ua ly f or th e vu lvm o l
aleep lng o hm whom their entr anc e
mi gh t ar o nle. E mptlu ea a wal h ar .
a lpec tral vacancy.bu t wi th n
were nelrher den h no r fe ar.They were 1|lln le ao ar t.an a
To lne u e Imqkm li ke a h mk e n
lo we r ready I n mn .
"W alt for me here." anld J eeme.* I a m golng for n u ur mf u l o f
xt-asa"H e mn d e u hed ln a c o me r o l
the room. a nd ' roln ette sa nk u pon
lr . He c over ed h er - ma ma mtn er '|
c oat whic h h e had brought h o mth e valley an d we n t o u td d e to
watc h and gua rd Ivlth Odd.
H a c ould hear her eobhl.u| .aa
I
I
l
... .....-........\......e...wu -vnu the Crowell Him.The are
gg-nmm wa s sp en t i n vi s i ti n g a n d
To o ld n g o ver th e Ho me. The Ho me
a n d l o a t i o n a n b u u t i l u l a n d we
sho uld fe el pr o u d to h a ve a p la c e
li k e th i n i n W a ah lng lo n c ou n ty .
Mr s .C a r l L u n d o f Fremo nlla
s p e n t th e f u x e p a r t o l l u t w a h
vls iti n he r As te r an d br ol.h er -i n-la w. lg r . a . n r Mn . E lme r L u n d .
Mr . a n d Mn . J o h n He d e lu n d o f
Omah a, c alled a t th e Geo rg e Iled e
lu n d h o me la s t Th u n d a y e vm i n k -
Mr a .Geo rge Me n k i n g visit/ed
th e i u r e p u r t o f l u t we e k wi th r e l-
ati ve s ln Oma h a .
M n .Elme r W r lg h t wa s I n B la i r
Th u r sd a y wh e r e elmo ha d de ntal
wo r k d o n e
M n .Ch a r le s Go ttlc h o l ne ar
Ben ni ng to n.vi d f e d wi th relatives
he r e la a t Th u r s d a y .
Th e r e wi ll b e n o s e r vi c e a t th e
L a th a m c h u n r h S u n d a y .
Ur a .Ha r r y W a r d e ll an d son,
lean ¢g _n9a_at laal g o give ~ gon [ W endell o f Crei ghton.we re di n-
Punuc
.SALE
On the Retxllff farm located V: miles soulbgut of Wuh-
i1\!¢0|I. 2 miles welt :nd 2 mile: north of Bennington
an the wmaty line.
Commencing at 10200 0'¢l0¢k Sharp
Saturday, |'ebruary I4
One of the largest sales in this
section to be held this year.
Free lunch at noon -Plane bring cup
mm RElZLOH', 0wner
Z i lr vf v . ; . . . ; ' ; . " a 1 2 ;
t u h e r h i bellevoé l o hl0 lf\ 1ll!»
' f o H e n r i B n ln l n . ¢ h | tn lla r wh o
h a d h - n u m ln . mn . . o u . . . _ Q. -
n vlg a h n d c o ma wh lle h e wu o nh ll - vu h o me f r o m L u n d : p la c e ,
a n d ' u p n i l r e n n a m f o r b d le vtn gth q y m a depaned ln m m .leav-
lu n .n o mn g n l u n e :|thic ka n n e r g u e m o f M i . a n d M n . H .c .I n g ln h ll thm t a n d Q h o t t h m t Hla c o Mo n da yI n h l l c y a Mas! _M y m N m Tu e a d n y e vn i n g ,Fa b.10,1981gg gg q y g gf nr h h mo un r. . HO. ! W . ie 1 ug Method m E niu aml .» ... .-. -».
- - _- -- . - n u a n n u v f v l L a l !l u 0 | l g 'F l l n l h w o m a n .O v e r h e r h t i | C ' l N I L
' l n f o r b i d d e n u l l e y ,m n t h t !
a n d m a n y a s t h e h a n d ;o r h n -
° °
.
~ e z = f z c e _ = r = = - = » e - ».
l u mm:M m u n gimematmp:or hu!!und 811111.whichuq would may bus uhm had
¢_§g_9u__lgsu v fvllqjfr gfgm
wuueu um easement mr hll grid. h ii¢U§hY'I:FE5 ¢Y T53 2Bn! |len00df-l mm. Odd Ilhthld »§"~m bum the While Eleplunt.
nlnnuzy md dnplnsly ld!! his E,`,.y°M || gnviged eo come md
"'"l°'~no e um u mm.
l | | n n ¢ .n l i l l l n n »r n | ¢| m n » u n ¢
I
~nn. s_n .n m nh nd
'smnmuddulrlrhomashv uddln
.E5_r._upuro}mu|vrnywg\un1m "" " "Is'..ir§`x£e""'m"' "5
un s -|ul¢.hrnnlm Fnbmnw 5. 1931
Blnir, ,pan Saturdn nigh!mdSunday Witt the Wldaet funny.
u w Mrs. Clydéldetzler wok
wMgndny where Mn.nisy maxed
thediCg;\:nxnt hgspital for an ap-
o ra an."°§uS¢ ., S L W m and n e w
Warrick of Blnlr Ind lhnhy Wu-rInk,who wo rks forFre dPe c ko ng¢ B=;,;=h..;»¢»= Sunday at the
eum a m s.Mr. a nd Hn. U.s. Reevu of
zuthNo! Blllr, mgunxfszther, Mrs.
An e u Y U !rg u g s t a o f t h e O p s ] a mi , ~
agm Hurduri ho me we re Mr-gg'
rs.ng -mnl i ne mi i nd Dr . i m. .. Hu r-
lmlay night.Sunday Ralph RIYntufnedwiththemtoLyonswhere he will spend a few days.
Ted Blnnkmxhip npent Sunday
evening at the I a Laymanhome.Mx. and Mn. John Qdnlnn and
children of the Haney district were
vidtom of Mn. Frank Pitzaer and
son. Funds Sundxy dternowrzm.
Mr.and Mrs. lm-m Layman
spent.Slmdly afternoon At thehome of his ister, Mrs. Pew El-liott Ind family, nur Tekunnh,Frmk Ke ll md f un i l tey.Sunday nt ¢{,parental,ohn
Kohler hom, naar Tehmnh.Mins Co n Benn!nsaluhed at
serving at tha 0. E. s. kenxingwn
Tuadny dtex-noon at the home of ,. ..-.¢
Imde Mancha home.Mr.and M n .Fred Olsen vil-ited nt the Jonu Blomberg home
Sahxrdly evening.
Misa Cla n K~ g=spent Wed-
nesday night with uby BadgvmwMr.and Mrs.Clark Uppineott
were Sunday dinner guests o!Mr. and Mrs. Ridnrd Sieven.Hr. and Hn. Plud Koenig and
son and Mr. and Mn. Carl Tenk-ho u md son,Prank of Omaha
vdmed nt the Charles Koenighome Sunday afternoon.
M n .Emma Hoover visited Q(
the Taylor French home from
Thursday until Saturday.. Mrs.I-'rink Marsh and son offreknmah,were supper guests xt
ltors at the Bd Holstein home.Mr. Andrew Anderson and Mn-leof Blair, were visitors at the Ar-thur Anderson home Inn week.v
Mrs.John Jackson spent h i t'l`ue¢dly with ber sitter,Mrs.
Raymond Magill.
Mr. and Mrs. Harold Curleymdfamily were Slhlrdny evening sup-
g°f guests at the Bert Thompson
ome.A surprise pony wu giv en atthe Earl Thompson home Frldny
evening in honor of Me!-a. it being
her 15th birthdly.A very enjoy-
able evening wns reported by all
present.A lunch of sandwiches,
.~~-. .»
with Mn. Petersen.John Zalodick shelled corn ~Wsdnesday.Mr.and M n .Jenn Cl ».
z Thursday evening atmy Efw g, ho me .
Mr. and rs. J. L PetenenanRohm. were Sunday altemoonlto n at the Chris Larsen lx~
near Herman.Elizabeth and Haul Sheets anVdma Hundorf spent Sunday dt
emoon with Gaorgia Antfll.Faye Ervey retumed home Wed
neaday szyeninw alterh - ~
as A ns er »Mn. Ed Elmlnger and fllui-{y l
Gnaha.
u
m , , w . m ¢ h a v ¢ ¢ m p w I n m ¢ » ¢ m ¢ u r a n n » a ¢ u » ~C R O W E L L H O M E l f ".hx un . A i r w _.here being live u u .1.5¢. ~and Mn.D m Thompmn. .Belles and Rvy AndernonHk h l d nx c-md m m w r e b m m s m a m -me new v m N? "m i m m my K-\'°Kb mo n .mu v mml .Q n..L n fH u .e. . . . \ »l l l r a n a l ! !\ . . \ . |I n u :-urn |»~..~.......-.,,........._._lin. Adset, Mn. l-len-en. nd Mm.
Bilton of Lincoln.Rev. Grosmlw and wife and
Hrx. Ludwig and her dxughtebin-
hi v i si te d the Home last week.
Thr! are from Fremont.latar Pilcher and his Brother
from Gluoo, Kuna visited their
imll. lln. Rice from Sunday night
miil 'hsadny marmlng.
'hae Kenmrd Ladies Aid had
v w . w w w u w . ~ - -------~-~--.. _-_._.-_ .. _. _.._.... ,.Mr. md ln. L, L. Plrksmlng ollthe lntter'| brothzr, Dick Blmkm-
Omaha, took Mr.md Mn. Johnlbeck.\er and hmily.
Hlneline and Mn.Geo.Hlneline|Mr. Ind Hts. Hnyzs RooenhlmggWapinzmWw=r S-l:|¢|Y;nn;°|3d #-==_;=g~ a ug Fri da cve~
t er n I -n z I rnM n .Jim Olsim of Kmmnd. home.
spent three days this week at the Mr. and Mm Weiwn LongwemDave Guxtin home.Sunday dinner guest.; at the homeHury Hlneline md family were of the lattein aunt,M n .UxdeSunday dinner guests at the c. o. Aclcenmn and family,wu z o iHineline hams.Herman.Mr.md Mn. c1yde ..Sn=_13w=|hi r , - ng HI !Merton Winchek
da d ! n gdu monthly mating at
d l Home Thursday afternoon.
There were thirty-Eve present ln-
du m numbers md visitors.
li n .Karla Hall swompaniad
ln. lloyd und Mrs. Webster to
~0m.llm Thnndly to consult with
Dr. Judd fgg eye trouble.The lnt-
ur runnin at th¢ Methadist hos-
were Sunda sei: at ina Lnurnnu anugntar, Irene t Sand:0. Hinellne '»..;§'. md Mn. Span-fn the Clemmem wn{&2.¢. ml
wnmdchlldren atnyadto.spendweaoforum.the week visiting.I Snnd|_evening visitors at tha
Mrs.Fred Guxdnrnnd child!!! umm,mchell home wen Mr.
want Mnndly to the home of her nnd Mn.Cecil Thompaau,Mx.
parents, Mr. and Mrs. Jlm Oban md Mn.In-mx Knoffleg md
' °»%i"'nL§'uY~»"1'i`a n " % " . , . d u n a m . u a ra
zweek at the MU o m. .n @ R o y . ~had 5 3 "
mam or U I ! ! - l l m u n u l l u ° y =n uS b v mm n f L in mln .Ib mt hc r ,G e o mes.a n a l m n u '"";f~1 ha d mn n e r d n t 'r.and M r ;C e a n n FnllnnI 6A'ii§mf'5i§f¥.1m |i`£"£i§L E352:f...,. hlmgtur ll" i i " Q ' ~a n a K r vm iamdMrs.GeorgeH=iun wsnellrfhtenen.
and Mn. Cui Bohn and Mr. usd ___
r. .a i;'."w.1i;e w»:=aa~m="ia'f. ;.;a'°'"iiésf " " " ' ' " ° " " " ` " 'The 1*"=»~= 11°me Vin:.a Fallen S»~=1;[v afternoon.Wedneada evening visitors at g ; fnrgeweek-end visitor! atMrf and rs. Floyd Smithmn the Hury gm, home ware Mr.H -~Crsta e.um; for W°m¢n._n|.. Sunday dinner uests of Mr. andland Hn. Prod Oomptpn of Blair,"il eases %°".¢'"»€2'2».f'm».t$l0.75 and #IWf"'.*:~. ggnfir n||.....- ________|1'- .and Mrs.Henry Taft md ,____,,,,,,, w.,|.,_,.,..., ..¢»._..-......
I
Mrs. Wm. arm.Winn" C¢.¢_,w " ' w ' °'*""°"';.,::.'1 er; ua w sas -° li
e m.vidMnm:: um Fashion °°°°'°'°
~ Lxyman was |B E N G ;
Jim for mme time for medical
treatment.lin Edna French wznt to her
M c C
I D N ! !m m m :
ana spmtme lnamoan Sunday UUthe Jens Jud hams.
. 1 , \ - . . ._ . . . _
-s - 1 : ~ r » . ' ; . ; . ' : ; " ; . ; , : ; , , ; , " . ' ; " ; a ' : ' a m: f mi lv < = f F r e mo n t.
MIN m v m u Ula . -- - . l ~f .~g.+..'5.,.2f.?" "*"=-..
u n s a w u \ : u . u c l | . | . l y I u u n l v v l l . ..u r .a n d M r s .R o h m
E ' * " ' E ' P ': ' : ° ; ' *" E "f ' " ' " Y . ' P $ . " 'W _ - Q # f r
LONG CREEK
Miss Karen Jensen who isteachingtheNashvilleadool
came home Friday for a week-endvirit at the parental, Cad M, Jen-
rs,enry e m gpevn rev-
"'£ i "°"`§Fl r
eral days thsogost week with her
sister and b er-ln~law, Mr. andMrs, John Aronson.She return-ed to Tekamah Friday.
Mr.and Mrs.Mark McDonald
of Omaha,visited Saturday eve-
ning at the parental,John Me-
Dolmld home.
Mrs. John McQua,rrle came ou!from Blair Friday and spent theduywithMr.and Mrs.J.H.
Nearhood,The Misses Edna and Rule
Thompson entertained a number oi'
friends last Saturday evening inhonor of Miss Ruie's binh anni-
versary.The evening was spentplaying game after which a de-licious lunch w served.
Mr. and M s.Soren Wolsman
and famll spe l. Saturday eveningat the Niels ristensen home,
Miss Ada Hanison entertained
at a dinner party at her home on
Thursday, honoring the birth an-
niversary of her mother, Mrs. Wm.
Harrison.M n .Mina Schmidt of
Blair, was also a guest of honor.her birth anniversary being Jan.29.Both ladies were presentedwilhbeautifulpottedplants.Abounteous dinner served cafeteria
was enjoyed.Mr.and Mrs.Wm. Thompson
entertained eight tables at eardr
at their home last Friday evening
Progressive high five was played
and high scores were held byMrs. Louis Schenk and Void lre-laud.and low scores by Mrs.
Ieslie Thompson and Roy Ander-
sen.Prizes were awarded accord~
ingly.'l"l\e hostess served n de-
licious lunch.A very pleasantevening was reponed.Leon Hindley shelled com forChester Aronson in the Rose Hill
vicinity Monday.Mr.and Mrs.Tom McDonaldnnd family ol' Herman, visited onWednesday evening at the paren-
tnl John McDonald home
Kenwood Aronson o l MluouriValley, is helping his uncle. John
Aronson with his farm work.Everett Aronaon and family of
Omaha.came Sunday and spent
the :lay nt the John Aronson home.
Mr. and Mrs. Howard Lund and
baby and Mr. and Mrs. John Hansen of Omaha called Friday at iheleonHindleyhome.The ladiesare nieces of Mrs. Hindley.Mr. and Mrs. Peher Jensen were
Sunday dinner guests and spent
the afternoon at the Carl M.
Jensen home,Thursday evening visitors at
the Peter Jensen home were Mr.and Mm Elmer Truhlsen and sonandMr. and Mrs. Hayes Rqsen~b:~'~\ and daughters.
Mr.md Mrs, James Thompsonand family were Sunday dinner
guests nt the James Mullin home
Prank Knoffler has rented the
Schenk Bros.form and plana tomove Boon.Miss Rrances Thompson of Omn-hn, r-e-t Saturdw at the MenonWinchell home She had the nrlr-14fortuneto full while roller dmt-xng,breaking her m n near the
wrist.Rev.A._Rasmussen spent theweek-end in Council Bluffs.re-
turning home Sunday evening.Mrs. Mary Barrv of Blair, spent
Sunday Welling with her son,Joh
Barry and family.
Mn and Mn. Icon Hindley entertained a number of friends attheir home Friday evening.Card~furnished the amusement for thevaiing,Mr. and M n .WeatoLong held high scores and wenawarded prizes,The hostess serv-ed ice ereu-n,nke and coffee.A
P c um e n wrx re
po;-(rand.-M s
r.Hnyes Roaenbalmma daughters "usa Friday Qve~
mono T HE
B(Yl'l'0M msn
Mr. and Mrs. A. R. Bode were
Tuesday dinner guests of Mr. and
Mrs. C. B.Bunn.Mr. and ~
ODA Raves and children
afternoon visitors there.Louie Psulsen of Denver. eldestson of Mr. and Mrs. Lars Paulsen
spent Wednesday with his pansnta.
I-'red Hurdurn drove to LincolnWednesday, bringing hls dsughterMaryandherroommate,Miss
Laye Stevens, also a mode shnknt
home Thursday.The girls return-ed to Lincoln Sunday.
Paul Tyson and Merle Lyon ofthe Kindred dlstrlct,\Beulsh Wsr-rick and Benjamin Beard of theBonoschool were at the Ulslr
court house Friday for eighth
grade examinations,
The Jack Hillstons family of
near Tekamah, moved Inst week to
the ten:-.nt house on the farm ofWm.Rutledge for whom he will
work this year.James Kehoe retnmed to theA. E. Dixon home Friday, after amonth? visit with Mr. and Mrs.A.P.Ely a t Elkhorn and other
Douglas county friends.
The Kindred Merry Makers met
Thursday aftemoon with Mrs.
Prentice Smith, who served a de-
licious lunch.Feb.12, Mrs. Geo.Hsin will be hostess when eachwillbeexpectedtonnwnrrollg y b y g i v i n g a h o u s e h o l d h i n t o r
c D~Mr.nnrl Mrs. Kenneth Tyson
spent Wednesday evening at Lho
nnrental, Art Baker home in Bunqounty.\
a :I L 1
Mrs.Bertha Gollehon,Sheldon
. . |&\`
ANNOUNCEMENT
I have been appointed as DISTRICT MAN-
AGER of THE MUTUAL LIFE INSURANCE
COMPANY OF NEW YORK and my entire time
will be devoted to life insurance underwriting.
lam representing the OLDEST life insurance
company in America and one of the largest
financial institutions in this country. THE GRAND
OLD MUTUAL LIFE celebrated its 88th AN-
NWERSARY February 1, 1931, the first policy
having been written February 1, 1843;°
I trust that Imay be of service to you and
your friends in solving your insurance problems.
L. E. 1fE'rEnsoN
I
Quality Flour
- @ - -
All the best brands of bread
and pastry flour at prices
that are right.Flour is the
cheapest good food material
you can buy.
EAT MORE BREAD_
BAKE YOUR OWN BREAD
~NOR'I`ll SIDE S'l`0RE
rnorw 113414 W E n n u v m
of Powell.Wyo..who came toOmaha with a shipment of sheep
for market have been spending the
past week visiting among oldweigrhborn md friends in this vie-
inity and Blair.Joe was born andreared on the farm occupied byHarry Tyson and left here eleven
years ago and renewing'old ae-quaintance has been mutual pier
sure.J. S.Conetv, A. E.Dixon. JoeAndersonandCarlBurgnerof
Powell, Wyo. drove to Fremont onSaturday for the stock market.Mr.and Mrs.Robert Widenerand daughter were Sunduv visitors
at the Hans Sorensen home at
Washington.John Andreason of
dinner em of Mr. and Mrs.
Fred Pec lnd family.
Mr. ana Mrs. Allred Hansen andchildren spent Thursdn~evenin~
,.~
Lunch at Noon Us Terms
dinner guests of Mr. and Mrs.Hurry Smith.
Mr. and Mrs. John Sutton and
Mr.and Mrs.Kirby Parker of
Omaha, spent the week-end at theClues Sutton homeMr. and Mrs. Alfred Hansen andchildren were dinner guests Sun-day of Mr. and Mrs. Hans Soren-
sen of Wsshlngwn.
Mr. and Mrs. Joe Verplanek ol
Amarillo, Texas and Mr. and Mrs,
Elza King and grandchildren vis
ited at the Harry Smith home on
Friday evening.-
Mrs. Emil Hagge and san andMarie and Margaret Koenig, spentSunday evening visiting Mr.andMrs. Clarence Olsen.The Bench Community Club
met at the home of Mrs.LarsFmndsen Thursday afbernoon with
nine memben present.Mrs. Em-ma Hoover and Mrs. Taylor French
were visitors.The afternnon was
spent embroidering quilt blocksfor the hostess.The next meetingwill be with Mrx. Gene David and
some way of prepm-ini and put-tin? away meet for n e summer
will be given when answering roll
esMr.and Mrs.Charles Koenig
ANDREW BECK,Owner
Jensen & Bron, auctioneers Farmers State Bank' clerk
»»
Friday vimltor.George Morrison d Tekamah,father of Mrs.Wm.Rutledv
pansd away Sunday morn .The neighbors extend their -
. and Mrs.R.M.Iversonand family spentWednesday eve-ing with the A. W. Clarke fem-
l v.Mr.and Mrs. David Mathews
and daughter of Omaha,were
spending Sunday with their par-
ents, Mr. and Mrs. Oscar Mathews.
Mr. and Mrs. Hugo Huck, Mr.
and Mrs.A.J.Curtis of BlairMr. and Mrs. Albert Curtis and
baby were Sunday dinner goeetsolMr.and Mrs.Byron Bunn and
children.Mr. and Mrs. Fritz Muller and
son and Miss Cora Beard drove toShenandoah Saturday to visit the
nurseries and radio stationsthere.
Mr. and Mrs. 0. M. Tyson and
Jerome were Sunday visitors attheFrancis Mehrens and Harry
Tucker homes.Dr. and Mrs. Charles Mead andsnn. James Mead and wife and
children were Sunday afternoon
visitors at the C.` B. Funn home,
ln the evening Mr, and Mrs. Opal
Reeves and children were then.
Miss Hazel Dohse from nearArlington,spent the week-'-dwith her sister, Mrs. W. J. Belteandaccompaniedthefamilytn
Gretna to visit a brother, Herman
on Sunday.-Mr. and Mrs. Bert Earwood uni
son of neur Tcksmnh, were Sun-
day evening visitors at the Byron
Bunn home.Mrs.Fritz Muller and Leland
ment Tuesday afternoon with Mrs.
Clyde Metzler.Mr. and Mrs. A. W. Clarke nrid
ning a t t h e ~
h~e, neu Drum.Larsen home, n~ Herman.Robert Rumuue n has beendaughfev i dt e da t !.h e E.C .L ipincntt lmme »S\mdny afternoon. P-
Qors with the R_ M. Iverson fam-
\ y.Mrs.Frank Pitzer and son,Francis were Monday afternoonvisitorswiththeLouieGrimm
family.Mrs.H m g Tyson,Mrs.Kenneth Tyson iss Gnce Ray andMrs.Jay ft'lcC'|anahan were vis-
itors ol Mrs. Don Metzler Friday
afternoon when they had their
farm sale.Mr.and Mrs.Harry
Tyson nayed for the evening.
Peter X. Petersen and two sons
of Lyons. visited Ralph and GrxceRay Friday night and with a bro-ther, Jens Petersen ot Blair, Sat-
PUBLIC S 11
I have decided to quit farming and will sell at Public
Auction at my farm two and one-half miles north of Blair
on the Herman road on ..
FEBRfJ"X"§i°rAi1, 19 31
Sale commencing at 10:00 0'dock A. M.The following
,property to wit;"
7-HEAD OF HORSES-7
One team, bay mare and my gelding, wt. 2500
One team bay geldings, 7 an 10 years, wt. 2900
One team, smooth mouth, wg goo ~
One bay mare, smooth mouth, wt. 1250.
1s-HEAD OF CATTLE--18
Nine No. 1 good milch cows
Three heifers
'I'wo yearling steers
Four calves.
2 0 - H EAD o r n o c s - zo
Twenty head of stock hogs, weight, 130 pounds.
Macnmnnr
gne hay stacker
ne sweepOne Deengi mower
One hay r e
One binder .
Two good lumber wagons
One hay rack
One g plow
One
One
One
One
Thre
Two
One
One
One
One
One
One
One
One
One
One
Two
One
One
Two
2-bottom tractor plow
Fordson tractor
harrow
disklpuuverizer
e wa ` g cdtivators
nding cdtivatora
planter
wide track lister
go devil
2-hole corn sheller
hand sheller
fanning mill
manure spreadergrinder .
uzz saw
cream separatormcubators
electric pump jackpump jack
stoves._
HAY AND GRAIN
Seven tons of alfalfa
Some oats straw.
Several doien chickens, and many otherar-ticles
»
I,
'w
~1511-
. :5 .`'::gg:~fr.
... .»..l ~ 51 ,Jimi
;;i . ..
, , . .- .32-
1
1
I
One ~ gang plow
One walkmg p ow too numerous to mention.
upawrs at the J.L.Petersen home Thursday.1harm md on Thundly Mn. Ru-hie r X.Peterson of Lyons,
muuen md Elaine and Mn. M. A.spent Saturday night with his bm-|Matz and Junior spent the dny ther, J. L. Petersen und family.g
NEW ENGLAND NEWS
Mn.Arthur Anderson Ind Ar~
dith, Mn. Chester I-Invendick and
E r n e s t S c h m id t O f f e r i n g ' o f
SP O T T E D P O L AN D C H I N A
Bred Sows and Gilts
.Fre mo nt, Ne bra lka '
Thursday, February 12
The sale stuns nt 1 o'clo¢k at the Fremont Sale Pulliam 2
blotks south uf Unlnn Stntlnn
A 50 head Mflerinxz wllh size. qunlily. colur
Also n 12 months nld Pure Bred Pulled Slwrlhom Bull
l lm o fferi ng Inu' mwn and gilu that will be a crtdit in
any herd.1 think you will like them and find them profil-
able.They lnve been fed and cared fnr ln precisely lhe
same vuy an the Bows l lm reulnlng.All lnve been fedgood brood sow ratlmus, such ns found upon the average
farm, llld have had plenty nf exercise, so I feel that there
is *reuon to exped large strung litters.
TERMS:-Cash.
ERNEST SCHMIDT
FREMONT, NEBRASKA
|'ll H. CRUISE,Auctioneer UNION NATIONAL BANK. Cle rk
ALL HAVE HAD THE DOUBLE 'mEAT:\ms1"-I-'o d CHOLERA
ALL SOW-S ARE cl',\rz,\N'x EEI) To BE IN mt:
Loftis home.Mr. and Mrs.Vick Skov wereTuesday afternoon visitors at tnehome of Mrs. Chris Holstein.
Mr. and Mrs. Harold Curley and
family,Lester Corley and Craig
Curley of Dixon,took supper at
the Herman Spdck home on Ian
Wednesday evening.
Mr. and Mrs. Chris Kuhlrnan andMr. and Mrs. Erwin Sprick were
in Fremont Wednesday afternoon
to visit their sister,who is in
the hospital.
12... John Jackson. Mrs. HenryHovendick and Mrs. Raymond Ma-
glll and children. spent Thursday
at the Herman Hovendick home.Mr.and Mrs.Edgar Skinnerwere Friday afternoon visitors atgh.. F. E. Fletcher home.Martha I-Ioier and Elns Peterson
.attended s hard time dance at
Blair Saturds evening.Mr.and J... Andrew Nelson
,and family spent Sunday evening
at the Walter Nelson home, nearBlair.Sunday afternoon visitors at the
,Grandna Fletcher home were, Mr.
and Mrs. Leonard Loftis and fam-ily of Calhoun, Mr. and Mrs. Geo.Loftis and Mr.and Mrs.Eddie|F1ebcher.
Mr.:md Mrs. Vick Skov and
h mm a t K mmr d for the week
-md.W a n n md Onfh George wan
home from Lincoln over the week
end. between senmsm-s of school.
l r .Ridschzr from Fremont
am: tn a ll o n Mn. Bra nd, wh:
is mnking her home with ua.
lin. lhll enjoye d a visit fron'
Edna Davis of Blair, one day last
Ie d r .
lr. and Mrs. Graham, Mr. and
Mnx. Wesdull brought Miss Nich-
ols ave! to help ua with our work
\!(I
here.
Mrs. Corneiin B. Rice was born
'\
on July G, 1857 in Blukstone, Ill.,
Iivdngaton county.She was the
daughter of John Wesley Pilchex
and Eliza Macintosh and the widow
of Benjumin Rice.The relatives
which she leaves are nephews ann
nieces, who loved their aunt very
muah.
Mrs. Rice cnrne to Crowell Homf
ou August 10, 1918 from FairmontNeb., and has been a beloved mem-
ber of the Home for Lhirbeen yearsMn. Rice was A lovable chame-
ier.She had a personality which
was admired by everyone and
which endeared her to all those
tlmt knew her.She was a patient
sufferer und was perfectly eoutenl.up to her lust momenm.
Irs. Rice passed away at Cro-
well Memorial Home on January
80, 1931 after sho had suffered for
n week and n hal!from a light
xtroh.She was conscious up to
twelve hours before her death.
A dmc service was held at the
funeral parlors conducted by Rev.
Parduu before the body wus taken
overland in Glasco,Kan. for burial.
bu. DE SOTO LOCAIS
Hn . 'W i ll S e ltz an d c h i ldr e i a n d
Ch as .0 .Hi ne li ne an d family
sp e n t Wednesday eve ni ng a t the
Ro la n d S mi th home.O n Th ur sd ay wo r d c ame th a t
th e y h a d to operate on Adelaide
Lan de rs a t the Cove nant hospital
f o r ac ute nppendic itis whe re she
is trai ning fo r a nur se. Pete J o nes
to-ok he r patents,Mr .an d Mr s.
"EH Lan de rs to Oma h a a t once.
S h e i s ge tti n g alo ng fi ne at th i s
wr i ti n g .
Mr s .A r th u r R o we , H.L. J ones
a n d Gu y W ailac e we n t to Mo n
d a mi n ,I o wa Th ur sd ay afternoon
to n e e the ir sister,Mr s . C .Ru f f
c o m an d he r n e w boy ,Waliace
B d e .
O n Sa tu r da y even ing,Mr .a n :
h i m Chas.0 .Hi ne li ne ga ve s
I EXTRA HEAVY
I Oalfec und Whipping Crum
I For Kish Quality Guemsey and
|Jersey CreamICall Early Dawn Dliry
|PHONEg2 o n 38
|La ke B.annum, Prop.
l n a t e d l n n e w i o m e i i a s h e
I m.AmAss1'iA<.1~|=1111.s
Ofllees in Sum Bank Bldg.ham 298 'Blnlr_ Nabr.
-m é hm Cl ub me t a t th e A
c . n ¢ m 1 » ° m 1 m m n m g .`
»'rm-1-:pxmp»x'cuua met Feb.
4 nt the home oi Mrs. Blyde M.
Allen.
Sman. new advance styles in Silk
Dlessez priced at $6.75 and $12.75
=.;
spe dll ma ine~: ~t~la ids ~for ~'mnistu~ ~hi ~ " °m|~, tm I~ ~ [uf vaipzeralao I U|;ive|:dty have
connnlction of the lame be re-mud brim! .m Jn 1928 and the high been lnnolnhed by Pzfeaident Er-
wv ed up to 3:80 o'elock P.H.. Mmnd 1.82 inf 1916.Delplte the land_Nello:| an members of the Ed-
popézty owner will prephre ,the
di tc h and ml :mme :dur p'pr i
m m All Coumdlmen pnsen: wz~
iv! 'AYE', the dotjan CZ1!'l'lod<
The Light Corrzzzaittee was sshd
to continue their investigation on
funn line building and m report
as soon u possible.The following resolution was in-
troduced by Councilman Jemm.RESOLUTION
BE I T RESOLVED BY THE
a no n AND COUNCIL OF THE
c m (OF BLAIR,NEBRASKA:
'That the report., plana, specifica-
Eons and enimntea of coats nov:
submitfed by the Rohrbouglx En-
gineering Company-Perkins L\b~
ora!-aries, special engineers of this
Gity, (or the proposed construction
of l-s wimming pool in the City
Park, by amid City, which said re-
port, plana, spedlications and esti-
mates of cost are now 0:1 file with
the City C1erk, be, and the same
hereby me accepted, approved and
adopted on behalf of said City.
KE rr FURTHER RESOLVED,
that said proposed swimmiryz pool
be, Rnd the same hereby ls, ordered
hnye been enjoying a visit from
Jonas' sister of Harlan, Iowa the
past week-end.
Misses Evelyn and IaVaughn
Moats went down to Lincoln Sun-
day taking up their school duties
at the state university.
The three weeks old infant of
Chas. Mortensen has been ill with
pneumonia but is reported as a
little better nt present.
Mr. and Mrs. Weston Long and
family visited last Sunday at the
home of Mrs.Long'a aunt,Mrs.
Fashion Center.3»1t
Oliver Hudleson is reported
qdbe sick,having suffered a
slight stroke of paralysis Wed~
nesday.
Mrs.Mary Anderson and mn,
Archie of Florena,spent Tues-
dl y night at the Myron Met-
dnger home.
Misa Mae Koupm.\n`is visiting
atthe home of her sister, Mrs. L.
F.States of North Platte, for a
couple of wceks.
squads met the Creighton debakrs'm.|.rketing by mmm ta be cm;-an thu question af! Free Trade in nlducud in nn oxdnrly manner md*
-_--. . . . . , . . ., . , _
ooxmcn. Pnocmnmcs JANUARY WABMEST MONTH
(Ccntinuodfrom page ons)OF LOCAL RECollDS
1 h -._.( Q o l g d n u e d l mm vu e o n e )
I
Mr|.C'ausWu1fi.|betteraf*ter'Irallixonofnen-Calhoun 'nua s a b o r t ~_la b_g§iI1§8l .cg1ler ~ t h i n .
The Goffae Club moat: Hg: ~ .(f¥'!1!1r!§§lr>%===°fI1=i1r f.g¢~~»;: .:3
ernoon with Mrs. Sophie Rach.~Mr,d Mrs.. J..A.,.3é¢n;;[nnck
Min Maggie Lowe of Herman .of Armarillb, Teaumlnd ra. Elzy
was a Wednesday aftemooia call Ki"B'» B°¢fY and Junior Kingidrove
to Shenandoah, Iowa last Wednes~er at the Elzy Kxng home.'day to vm: the radio stations.
J |Mrs. Henry Wrich is much im-
u o c AL o vm u f n o w
conference u h m l o r D m w i l l
be with Midland College, Feb. 23.
The Viking baht _bell playen
neenmpaded by Coach "Tex"Jon¢s
will travel lo Chu-indn. lowafrues-
day where Dan; will play Clarinds
Junior College.The Board of Diredxlrs of Dunn
College met here lut week for an
lmporunt business meeting.
The i i re thrr uwu go nb o xt o be
mme by the enrpentry clus was
sold to Mr.Arnold Hansen of
Ruskin.At the student body meetinglastweek,Arnold Sorensen \o!Dannebrog,Nebraska was elecled
editor-in»chie! nl the Coll-age pu-
per "I<Iennes".He i also work-ing pan-time as linéfgfpe operator
at the Danish Lutheran Publish-
ing House here in Blur.Mr. Sor-
ensen expects to becoine editor of
the Dumehrog News dt Dsnnabxog
next yeu;,__.4
Acting aident Erland Nel~ ...~
and Mr..Chriswnsen of :.1
both members of .the Nab ~_"Committee for the Olympian F
to be held ln Lou Angeles in :IX
attended the meeting bf the com#
mittee in Omaha, Tuesday evening.
Dr. H. J. Arnold of,Wi1.tenberg~
College, and Dr. gf.. W. _Kmencke
i n g i n th e mo n th # u t passed-I.;
degrees on the mowing of the 14:11,
wi th but 21 the hi,"; I1 point on the
13th.Durin g the day time 1: \. ..\:
below fre ezi ng jllrl. [ our of th e 3 1.
day s,ju s t 22 on t' r o e da y s an d
dbovc fr ee zi n g th e o th e r 2 4 d a ; - .
il;J an ua ry o f 1921, 4 above wa s
th e lo w po in t o f th e mo n th .I n
151.9 it. touc hed 20 below, and still
th e ma x i m u m tempe ratur es ovar-
nged 40.3, sec ond on record.
Th is J an ua ry mak es a n in te re st:
i n g c omparison wi th J a nu ar y o f
19 30 , wh en th e mo nthly mea n wa s
12.3 as agli list 31. 7 th is y ear. The
ave ra ge ma x i m u m wa s 42.7 th is
y ear and 21. 4 lo st y ear.T h e a v e
ra g e mi ni mu m wa s 2 0 . 8 thi s y e a r
an d 3 . 2 las t J a nu a ry , wh en it wa s
above fre ezi ng b u t one n i g h t i n
the mo n th a n d beiow zero twe lve
nig hts,tou c hi ng 17 below o n thc
17th.
Th e c o ld ts t J an ua ry on rec ord
was in 191 2, with a mea n mini mum
g f bu t- - l. 5 ,th e me an n1a;;in\um
o f 17 a n d a mo n th ly me a n of 9. 2
N o oth er J anu ary on rec ord pre-
tends to e q ua l th a t o n e sin c e the
.n ....l
I n d i vi d u a l
Hog Houses
. . . are the real thing Mate
ial is down in keepin w'g xh
the parental,August Rathmanhmm.'
Mr.and Mrs. John Hooks of
northwest of Blair,entertained
four tables ol friends at pinochle
lust Tuesday evening.
The Wesleyan Gdld will mem
with Miss Pearl Iverson un nonh
Walker Ave.Friday afternoon,
Feb. 6.
Mrs.Rasmus Johammen enter
tained three tables of friends at
cards lalt Monday evening.Thrhostess served nice refreshmznts.
Mrs.M.D.Newell returned
nw.u=aM;»..A.J..._.1~
v1»=..;@:=1=@m-f2r¢1f»r°¢;**=#.'='.'
iiriwe td Lincoln la§\.;\18$dla
_attend a.Christian glgurth 1 ~ing wwe uié penadoi: *fund 54|
ona of the impoftint suhjccté g.,
discussion.1 .
o n c m s n ~
P R U N I N G D E M O
_
l ' S T l ¥ A ' { l o B
.*"n .
Professor E.H.Ho|:Tpert.,° lllié
congenial orchard sfvcclalist from
the Agricultural Co lege at Lin»
ooln, will bo in Washington county
for public orchard demonstrations
on February 26 and 271. according
to information received from the
local Fam! Bureau office.
To date, no meetings have been
definitely scheduled, although two
farmers have tentatively asked
for demonstrations at their fanna.
Hopper-t has held orohard meetings
in all parts of 'Washington county,
and those chairing to assist with
the local demonstrations and YU?ceive help with their orchards
should notify County Agent Geo:
Batesnrho will arrange Mr. Hop-
pert's schedule so as to reach the
largest number of orchard meli
during his two days'work ln
Washington county.
it Orchard men desiring assistance
rc urged to act quickly iniofderto get the location and théfhour
of each demonstration published
next week.
. » . ~
Mx.and Mrs.C.M.Meats,
Bobby Ind Billy of Ommlm, spent
the day last Sundny at the Elzy
King home.
Mrs. Henry Christensen is spend
ing a few days this week at the
home of her lon, Donald in Oma-
ha.
Mr. and Mrs. Raymond Cook of
Sioux City, spent last Sunday at
ning for Mr.and Mrs.Fred|HOM COMIN
Dixon ol Ft. Calhoun,Mr. and ._ ,_-1MrsG. G. Hines and Mr. and'The Rebekah lodge held one o
Mrs. Wm. Scherdin of this ciky.f their popular home cominKS Lbs
Mr I.nd Mrs J A Ve l kI....rp enc ;Tuesday evening when arounli Hx
o t Annlrlllo, Texas,who have ty members were present tobeenvisiting at the Elzy King thehll call and letters read fm
home the past couple of weeks 'absentees irdm many states of th
will leave for Des Moines,Iowa unionSaturday, Feb. 7 to spend a week A lunch was served at a lavisiting fdendn.!hour hy n committee in charge.
ing .f da ys ~~ k a ~ t h ~
h o me o f h e r s o n , D mm ld i n Oma -
ha .
Mr . a q d Mr s . Ra y mo n d C o o k o f
|.....
»I |.b e e n v i s i t i n g a t t h e E l z y K i n g t h e r o l l c a l l a n d l e t t e r s r e a d f r o
h o m e t h e p a s t c o u p l e o f w e e k s ' a b s e n t e e s f r o m m a n y s t a t e s o f t h
w i l l l e a v e f o r D e s M o i n e s ,I o w a u n i o n
S a t u r d a I-`by ,e .'F t o s p e n d a w e e k A l u n c h w a s s e r v e d a t a l a t e
vi d t z i n g f d e n d s .h o u r b y a c o m m i t t e e | 1 1 c h a r g e .
th e pa re ntal,A u g u s t Ra th ma n
ho me ..1
Mr .an d Mr s .J o h n Ho o k s o f
n o r t h w e s t.o f Bla ir ,ente rtai ned
fo u r ta b le s o f f r i e n d s a t p i n o c h le
la s t Tu e s d ay e ven i n g .
Th e W esley an Gu i ld wi ll mem1
wi th Mi s s Pe ar l Iver so n on n o r th
W a lk e r Ave .Fr i d a y afte rno on,
Feb. 6.
Mr s .Ra s mu s J ohannaen enter~
tained thr ee tables o f fri en ds a t
c ards l a l t Mo n d a y even ing.Th r
hos tes s s erved nic e r efr esh mzn ts.
Mr s .M .D .Ne w e ll return ed
f r o m seve ral wee k's vi s i t a t th i
E .S.Ne w e ll ho me i n Ar li n gton ,
la s t S a tu r da y .
Mr e.My r tle F o wle r o f Oma ha ,
dr o ve u p Th ur s da y m o m i n g to
c a ll on Blai r r e la ti ves an d f ri e nd s
Th e Enter pr is e of fic e ac kn owle dg
es a p le as an t c a ll.
Mr .a n d Mr s .Ole Jac obsen en
te r tai n e d Mr . an d Mr s . H. o . Hu r d
a n d son o f Oma h a ,Mr .a n d Mr s .
H .C.J ensen a n d Mr .an d Mr s .
J o h n Ho o k s o f th i s vic ini ty la st
Sund ay .
Mr s .Osc ar Gu y e r,wh o wa s
ha stily ta k e n to a n Oma h a hos-
pi ta l s uf fe ri ng f r o m h e mi a ,if
reported to sti ll be i n a c ritic al
c o n di tio n b u t hopes are he ld th a t
she will be better soon
Mi s s Ma e Pe te rs e n, f or mer c ity
teac her i n th e W e s t W a r d sc hool
a n d he r au nt. ~ Mrs .J ungersen.
dr o ve do wn f r oi n * No r fo lk Sunday
I..
Individual
Hog Houses . . .
. . . are the real thing Mater~
ial is down in keeping wi t h
F a r m Produce.O u r price
are the lowest in twenty year
f WONDERFUL BARGAINS
Phone 3 ~ Phone
CHRISTENSENLUM§5E¥§Ng£l¥{§ANY
home on College road.Miss Pot
Prscn is teaching:in the Norfolk
schools.
A FAMILY
DOCTOR'S IAXATIVE
IS BEST
" " ~ ~
"L ~ # 3 .~an
r w *.e'J F3 -If" L-~ e = -~ "S --~.\.,| |;.-'~.`=T
~"'lv:~~`°'/. f '» ' , { >~ 1 :a r e ~
~. l 1 ! ! &' f e \Q § L 1 » } »f f
|;1 . . ¢4 ' . : f ¢ ' f '~:f
._ ; : ~~: » -. ~ ~~.;
. f / *J ~/
3 |~Z .1 :, / J
°t = r . . } . , ~"~
.. i r ~ / /
Your health is too important!
You cannot afford to experiment
with your delicate bowes when
coated tongue, bad breath, headache,
gas,nausea,feverishness, lack of
appetite, no energy, etc., warn of
constipation.This applies not only
to frown people, but more particu»la ry to children.That's why a
family doctor's Iaxative is alwaysthe safe choice.
Dr. Caldwell's Syrup Pepsln is
prepared today under strict ahora-
tory supervision from fresh Iaxative
herbs and other gm ingrdents,and exactly accor ing to r. Cald-
well'a origmal prescription.
Today millions of families relyon Dr. éaldvrellk judgment in the
£§l°"'é'.L'.1 0:11 theér laxatlve._F 3
.w 'a yrup ut,
sixties read for utge, lsoisinnlll
orea,snow e argest -Jn: axmivo in the world!
o c y M r g g g n j 1 5 2 I n 1 9 1 5 U g g p n e t n e u l l l l l u n r. : | : a u . . |u n l l l | . : l u U ¢ | . : §0 1 L I I E . n u I L e g l g J B D B G D o f H e r m a n ,s p e n tc e z v e a u p t o ; 5 : a s u o c l R .. ,..o f F e b r u a r y 2 0 ,1 9 3 1 ,a t t h e o f f i c c l r e c o r d o f b e i n g t h e w a r m e s t J a n . l u c a t l o n s l R e s e a r c h C 0 l n m i t t e e o f t h e w e e j g n d w i t h L e l l h H u h ;a t
t h e N a t i o n s L t h E d t i o n a l h 'o f t h e C i t y C l e r k o f t h e C i t y o f i u a r y v m h a d b u t 2 0 c l e a r d a y s ,B
B l a i r ,N e b r a s k a ,a n d t h a t t h e r e c l o u d y a n d 6 p a r t l y . c l o u d 3 . ,t h e
a i b z r s a i d b i d s b e o p e n e d a n d c o n -f r e c o r d f o r s u n s h i n e g o e s t o 1 9 2 8
s i d e r e d b y t h e M a y o r a n d C o u n c i l w i t h 2 4 c l e a r d a y s ,5 c l o u d y a n d
o f m i d C i t y .| 2 p a r t l y c l o u d y .I n 1 9 1 9 t h e r e
B E [ T F U R T H E R R p } 5 0 L v E D | 1 . \ e r e a l s o 2 4 c l e a r d a y s ,4 c l o u d y
g h - =f i g C i C l e r k b e ,a r i d h e l a n d 3 p a r t l y f " ° " < * » j
° ' ° b Y s .s o 0 5 2 9 5 a n d i s d i r e c t -,T h e p r e v a i l i n g w i n d w a s n o r t h -
: ° : . ' . " : . ; : " f f _ :" f f i i f i ' f ' . " { ' i ' ¥ ' E 2 ` i f ' f | \ f f ' " *~' F b o a i n : l l b u t t h r e e
Conference..
A new course in Advanced Dun-
ish Litemture is being offered this!
semester by Professor C. A. Stub,
head of our Danish department.
SEARCH DEATH PLACE or*
FIRST NEBB. MISSIONARY
I u ersn uca the Geo. Kuhr, 15 ome
Wo:lens and Misses Shoes--
vui\.:e~;to $6 go at $2.98.Fash-
ion Center:3-It
Miss Helm fioopke Ieft Saturday
for Chicago to visit her brother,
Russell and family.
For Ren 'I'his spring,fruit
and chicken farm.Mrs. H. Miller
hlZ.: .n::J\ \ . l \ t : | . u | u n ul .n c n l u u u .
Wash Dresses-$1.95 values sf
at $1-sizes 14 to 46--you wili Sa;
they are a mal bargain when you
see them.Fashion Center,3-1|
Mr. and Mrs.Larry Bohan and
son of Omaha, visited isst Sunday
and submitted to an operation at
the Methodist hospital in Omaha
on Monday.
Mr. and Mrs. Earl Caldwell en-
.m.u n it uuu |.u¢u:::UL I1=f=IVlHE'Januar3.s sincesai q bi ds a nd the purpose thEI!!0f,| hg1,g been ke n t th e loc al r=cords -
On three J nn u-F`ift)~fivc y ears af te r Co lu mbu s
md southwest tied.discovered America, Padre Juan De
ellaneous Phenom-Padilla, a priest of the Franciscan
corded in January order,suffered martyrdom.He
or Blair Top and Tire co.uiilrr
Mr . an d Mrs . Ch a s .Ko ep ke vis -
i tvd o ve r th e we e k e n d w i t h rela-
ti ve s a t Ha r la n , I o wa .
ter tai ned a t di n ne r la s t Sunday ,
Mr .an d Mr s .Geo.Mu n d o r f ,Mr .
a n d Mr s . L o u i s L o we a n d Mr . a n d
Mr s .Fr e d Lo n g a nd f a mili e s .
Mi mi Prlnn 'Hnaw|ri\!r n f hinrih
18 ll9 lln b 0 fUI ? f i xe d , to b e g i ve n 31-yg l10l'thW¢8 g
b y pu bli c a tio n p r io r to m d date,A mo n g '°1\1i5¢¢
onc e eac h week in three succ essive feng"the re is ra
WCCRIY i88U€S o f Thi?En|'.&rDrise.f».r 1001 +!...|fl...a .z...§ lfoll ninrmui with nrrnua n¢ lanc f alni Mr s . Mab e l S tr o vk fQ;'3,.°£,¥¢§,f§f3j2 | B¢};`&I"¢a`£1`§Ié&n;"i»&;T§m Zi; 5;;.;;;-" r " " "u a h a h a .L u a u H U I L C w m a { u || . | u | ¢l " " ' |r - - - ~. u . u n u » ¢ v r v o v i .u u a b u ct h e o f f i c i a l p a p e r o f S g r !C i f ) ' » | i n g t h e m o n t h " .I n 1 9 1 9 i t i s r e -I n d i a n s ,i n 1 § 4 7 .T h e p l a c e o f h i s
b e i n ?a l e g a l w e e k l y \ \ ' 1 = P 2 P f r , ¢ < n - d e d u m " T h e M i s s o u r i r i v e r m a r t y r d o m l s b e i n g s o u g h t b y
u b l z c h e d a n d o f g e n e r a l c i r c u l a -b r o k e u p a s f a r a s Y a n k t o n a n d C a t h o l i c a u t h o r i t i e s t h a t i t m a y b e
t i o n I n a m d C n t y .' p l o w i n g a n d d i s c i n g w a s s t a r t e d m a r k e d v r i t h a f i t t i n g m e r n o r i a i .
P a s s e d a n d a p p r o v e d t h i s s r d l t h e l a t t e r p a r t o f t h e m o n t h " .T h e l a t e ` F n t h e r S h i n e , o f P I a t t s ~
f ' . 3 \O f F é h f u h f v 1 9 2 1 . \ v _ : n . . . .. . . _ _\_ ._.. I n n . \ n ¢ | \. . . l . . . . -l . . . . . . . . l . . A _ . _ ._ r \ f l . . .
is vi s i ti n g a t th e F r
ho me f or a f e w d ay s .
Mrs. Alic e Rowe sp1
day a t th e ho me o f
W m.S mi th an d f a m
\ . . _ . . . .
mm uuu5¢u»»
em. last Tues-har brother,
diy.of Cal-
and Floyd Hi nz o f Blai i were
guests at the Alfred Feei home
last Saturday evening.
Mr. and Mrs. Jack Crowdy and
dnukhwr. Bess were dinner zuests.if'1§a}}§&
Attest: C. E. Krause,
City Clerk.
Moved by Councilm
ucond y Councilma
that t.hu.;t||ove resolutir
ed and tiopted.The 1
put and upon roll calJensen,Moore,McKa}
Hundahl and Roberts vo
E
""~;'----;=~-f 3 t ......_to f all with in th L to l lar. $1- sizes 1- 1 to 46 o u wi lls atzngAX E'I ff."?§ 'Zig c w Q?f}_f__V,?P__P' 7'1 Im.. n":+.,1 ¢.!§¢§»?o ern FY lmlts o f lf h n u u r n n usual Inavrn{v): ....1...... ....friends gathered at the E. E. Ep»
perly home on Tuesday, Jan.27,
and gave them a surprise,the
occasion being their twenty-ninth
~~absent,gud fmng neu, auczu 9- D W¢.BLll€l -UD5El'V¢r.u n r" " ; ;" h § ;° ; ; §~gilthen-;¢;;th;r;:.,_: °"' .; ;*' ;,; *,; ;;. "°" ~
\'0§;11g DZIA ,the Ma y o r dec lared C 0 U y T y R E D C R O S S tic ate d the fac t that Pa dre De Pad-Glabron barley seed, 901: bushel;
5 ;r e a o u on pa ssed and aop rov-RA I S E S Q{ r 0 ' | - A i lla ac c ompanied Coronado,th o see d oats, 40 c bus he l;Rose C o mb
request f o r Uermission fn |§'»Pa{1iaI} §<}\ontu{er,_ who.a t th e Red h atc h in g e gg s, $ 3. 00 pe r 100.wedding anniversary am
Eppe:ly's hinhday.Th
vited nests bromzht ah
:V also Mr .
he se lf in-
m g a fi ne
he evenirm ity and now Li rg e Bxlloon
n l l
b n a Con uistador ea 1 3-tf Gle n W i ls on''" " "."Ly le (Buyer.c h ai rman o f thc'neac l or m s a Q »c onnec t a parm Q! T a x L o t h u m -W hi ng to n Co un ty Red Cross s e t o u t f r o m Me xi c o i n 1541 i n Mr s .F r e d II o a r o f W althill_
_asb e r a s to t h e m f S ° " ° " S y s t e m c hapter,in f or ms th is offic e that S g r c h gg the legen dary M 0 1 1 spe nt l m week vi si tin g he r mo
h e Of b0I0.HiStofiR!1Q diffmn nk-..\|.....1 nr n-__..\.'..§".?,...""I'E'f1' .¢_§_fc ve _and S a -th e nu ota f m this r n u n tv has Cl s
six o'cfock dinnerand tl
n o u slwaar a merrv one for ail
.,_Friends and relatives surprisew
Mr .a n d Mr s .Ilolrrer Ha n se n Ins;"°"' ulle &"."""".§f°f»..'E"""i!éé=» ;"" \I|§i¢|-ib§&`a1'Ii§ii ti;-;,|u u».u»¢f¢;:¢n; &£""""'B'»`j5I\}1|`""'|.|"§§,,',I' nf. null: "':";'°"r BED UEEN
u m l n u m w a s h e r
jperty ~ `=1H"§n2m§H£ E{,u§f°¢$'~
cents per foot for that part of thelot upon which the improvements
are located.All Councilman pr~es»
ent voting 'AYE', the motion car-fied.
The proposition of Ice manufac-
turing and purchase of ice was
discussed and the City Clerk wus
ill$ilI1ClL2d to obtain nricnn rm tha
[Herman and Arlington chapters
insisting in the subscription.
The following were the last con-
tributions: Carl Kolterrnan, $5.00;
Wm.Gosker,$5.00;Catherine
Siert, \$2.00;Martin Bertelsen,
;2.oiJ;e n ,$2.00;Edna Krogn,
-$2.00.\The entire list will be published
ney, but the evidence seems to'Mrs ~ Bugeon left l.eéj5,Rjy|Shl:urxil;y "Q§e=1}H;}§"¢rfé 5£é§.§§5|
favor Nebraska es the point where
the expedition tumed hack and re
turned to Old Mevico.
De Padilla, zealous in his deter-
rnination to convert the savage
tribes to the Catholic faith, return-
ed in 1542 with 2. small band of
followers.He fell,pierced withnext week..Ȥ.,.,,,., arrows, as he knelt in pray-
for Chicago for an extbnded visit
with a son and befor:returningwill gc Lo .Kansas City where she
will viwit unf ther son.
Mr. and Mrs. Frank Stricklett of
Blair,and Mr.and Mrs.Lyle
Stricklett and baby of Ethan, S. D.
spent Monday evening at the El-
bemg their nineteenth wedding
anniversary.Those present tcenjoytheeveningwereMg../imc
Mrs.A.J.Sutherland,Mr.am
Mrs.Hugh Sutherland,Mr.am
Mrs.A. Clyde Allen and daugh
ter and Mr. and Mm Chas. Lamb
Mm.Mary Miller of Milford' L i n k " a r f : | n n n \ \ 6 » \ - n K l a n l . I . . . . . I .
No other offers all these ad-
vantages. Aluminum or Porce-
lan double Wall Tub, Enclosed
Mechanism, Self oiling bearings
and Guaranteed durability at
a saving of $S0.W.
These washers have proven
most satisfactory where` ever
we have placed them.
The ARNDT
' I l l A n n i i r A ' l u i s
-5
5
Z;if
§
§5. __.
~---f - - - - - ~ - - ~.s -f hi b 'uk-cost and submit sa.me at the next|sIx yE,\R QLD (NRL §§~¢:1r::?1;rm18a1?dships8 b§}'$'§e tey
m e e t i n g o f ~ C o n n e l l .S T R U C K B \ ; , A U T 0 r e t u r n e d t o Ma a ad c o n i n e y e a r s
_ T h ; _ _ f < § } ° " ; " g . b} }' ? E . r e r €` :_l l a t e r .O II C B t h e v w o r n M a n h n - n f l
.... . <.....»...wornwllwIL G. Allen
Robinson CafeMencke Outdoor Pub. Co,
Fnrnberg Hardware
Christensen Lbr. Compan
Ed Stricklett
Sam CheelyL w . u m v
Sam S ns
James Rhoades
9 wrun
y
18.007.502.003.5048.52is.sn 1s4.on o125.00
120.00
Little six year old Virginia
Vaughan,older daughter of Mr.
and Mrs.Burl Vaughan of yhis
city, stumbled in from of an nw
mobile driven by Doris Tilden
while puki ng the West Ward
school Inst Wednesday and hfsrleg
passed under the wheel.
Hxarninnlion revealed that therc
10.00 were no broken bones and she is|
by Indians, beaten, almost. sterved,
and forced to serve as slaves.
They finally escaped and aff/:r
years of wandering reached theplace from which they staied nine
years before.
Under the direction "of Bishop
Joseph Rummeel, of the Omaha. d.l~
ocese, an inquiry has Been inst.\»
tuted to find and murkgthe place
'Bmce Dennis
David Norris
~ ~ resting very comfortably.Where the Spaninh P524 gnvé his" M The accident seemed lo be one hfe for the cause of relikion.
"" " | o f those unavaidable ones that T§g;=»v;=_s~==1~===3 mmi o n ml y happen and i¢was MAKE NEW <,1zoPs
J [__ Pounds 3432 very fortunale that there were no SHIPPING RECORDS1'broken bones.`3 i ; i " § . ; ¢ Z Y ~~Shipping records for 1980 are
H E. Tyson m y wh o c A' ru o u c c um P AR TY just coming e., light in Nebraakl.
c_N_ W_ R_R_ Gomoanv 1'z2.sa|WELL PATRONIZED They ,show that what was n dis~
n l - u : u J V V l \ l t l S
5R L A I D N m u n e u nilllllIIHIIIHIIllllllIIIIIIIHll|l|||||IIUIIII||IIl||I||||I||Hl|||IlRII|IIlIIH||[|
with your delicate bowes whencoated langue, had breath, headache,
gas, nausea,feverishness, lack of
appetite, no energy, etc., wam ofconstipation,This applies not only
to ff°~"= people, but more particu-la ry to children.T'hat's why a
family dodor's Iaxative is always
the safe choice,
Dr. Caldwell's Syrup Pepsfn is
prepared today under strict ahora-tory supervision from fresh laxativc
herbs and other g"f° ingedleuts,
and exactly accor ing to r. Cadd~
weJl's original prescription.
Today millions oi famlliu relyan Dr. ¢|.ldwell'| judgment in the
f?l°°'é°£'¢ °§u=1=¢g laxalgive F g
.w '|ui,§»=»=» read for u . lms llnwlll
ofa ,| now e urgat -Jn: anxivs in the world!
fjlllllllllllllllllllIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIlllllllllillll|||||l||lll||||Illllll||
_ .1 =
-''21 f' f f 1 =
enng Cadmnfs "At Dnwning"nnd
the popular song "Dancing with
Tears in My Eyes".She was |c~
eompanied by the Jenny Wren
orchestra with Ruben Cuscadeix
as leader..
Gilmore LeRoy Decker of Waxh-
ington, graduated from the Uni-
the end of the first semester term.
He received a degree of Bachelor
of Arte from the college ol arts
nnd sciences.One hundred and
sixty uni wmty students were
versity of Nebraska last week nl
where Mrs. Warrick was uw .ake
the train for South Bend, Indiana
for a visit with her parents and
other nelafives.I. N. is living up
lh Burt eounty on n farm which
he owns dawn near the river and
he oenalnly loolga prosperous and
comfortable.1
,\"\,um-§¢£u» Highway No. 'ze
|w-ill be paved from Peru corner tr
I-Iowa comer, distance ol 10 mil"
scuth of ihin place, and work will
granted degrees at the mid-winter be sumed this spring and com-graduation.lpuewa as soon al pondbll.
S AF E W AY AD r o n W E E K m o m s InFEBRUARY 1. 1931 IN OUR Imam STORE 'T
Aff=WA¥i~§?f912H
[.]'c o m m s N E Y
Jumbo Bruld Pure Country Safeway Blend in the Orange Pure,Produced and Packed[..]Delidous for Cooking Bag.Gruund Fresh Daily in Nebraska, five mundpaih
r:AcH-__,_._.s l POUND._____.,__,__2 5 C _\
.|
ln e r F r a in h o me .
His car was wrecked trying to
Save 60 4 :- to g e t th a t la st thous-
a n d mi le s o u t o f a smo oth tire.
W e p a y y o u f o r mi lea g e le f t i n
oiu me a .Ga mb le Stores,F r e
mo n t,Ne b .3 4 1
An o th e r le tte r f r o m Mr s .He r -
ma n Shie lds' to Bla i r f d e n d s rc -
ve als th at sh e a n d he r s i ste r h ave
reac hed Ca li fo rn ia a n d ar e n o w
ba sk in g i n th e sunshine o f th a t
pop ular r es or t.
M r .a n d Mr s .W m .Li n de n a n d
f a mi ly ,M r .a n d Mr s .A u g u s t
Ra t h m a n a n d Pe te r L a d w i g at~
tended Mr . a n d Mr s . He n r y Soll's
twe nty -s e ven th wedding:ann ive r-
s ary at Flor en c e la st S un da y .
Fr i e n d s o f Mn . Ge r a ldi n e S te w-
nre were glad to hear her sing
over KOIL last Wednesday evening
a._: ~ I l i !~9 1 :
Ne h .a n d dau gh ter s,Mr s .Ma ud e
Rolfg on o f Po rtla nd ,Or eg on an d
L i r a A n n a J enn ings o f Oma h a ,
we re vi si ti n g at th e ho me bt' tii ei r
da u g hte r and sister,Mr s .0| c 'ar
Guy er las t Satur da y wh en sh e ivan
ta ke n wry i ll. Mr s. Guy e r' s d au gh -
te r, hi m. An d re w Mad s en of L y on s
wa s also ho me a t tha t ti me .
Mi es Ge rtr ud e W a rr ic k,dau gh-
te r o f Mr. a n d Mrs . Neu m W ar r ic k
sub stituted f o r he r sister,Mr s .
L .G.Ste wa rt, lus t Mon d a y at the
Mc Ca rthy sc hool whi le M1's ._Stc w-
m :nada n business tr i p to Li n -
coln.She sta y ed a t h e r si s te r s
roaming ' plac e , a t th e D . A. Co mp-
to n h o me i n Bla i r, whi le teac hing
for h er , an d a ls o se ve ral d ay s fo l-
lo wi n g h e r r e tu r n .
Mr .I .N .W a rr ic k ma d e a
friendly call at this office lastFriday.He, in wmpwy with his
~
| 1 1 4 a l l n o u n i v c a l
He r ma n L a d w i g
Li o y d C ha mbe r s
Gra c e Str uve
135.00 ""'§ ,;, ' " "'il'j'°" -- -, -V .M. .. r"a |----....~..|.|lld mllpplllg pulul.ni10o. 0u| °"°a c oxc e of th e g ame th ey i n th e b i g wh e a t c o u n tr y a n d th e
100.00 pre fer red to play .ma jo r i t e m wa s whe at, o f c ou r se ,
1 m m |Th er e we r e a l a m e nu mbe r o f 1.250 c ars o f i t vnnnllinrr nhnnt
Richard Daniels
Amdt Hardware
C. W. F. Coal Company
G. L.. Dixon Company
....-" I -1----"o °"""'~ very nice prizes both for highI2,500,000_bushels.There were 265
343 scores and for lucky numbers and cars of Ixvestock containing 11,000
1533; everyone seemed to enjoy the eve- head; 293 can of .beeu, or 15,0001'rs,2sf"i"B"° entertainment.'&°"H¢ 14 cars of mlscellaneous uro-
(LE.Gust.in
.____ _ul. uuuccllmieotli commoames, mahbe"§'o"§;'"§8°"`°""§& ~ "'"'|The Dana A Capella chai ing 433 cars in all.Big Spnngo
n m In dmm on the ;'"'.wm¢h was one of the first A Cap- is a ffown of 'zoo in Deuel county.fm, in payment of me san; Ig; 'wana Quoin in Nebraska, is doing Alhance newspapers continue to
roll an, Blgdov gundam ~ §nt¢ena1ve work in preparation for ¥'FP01t heavy shipments from sta-wl. Moore Mex;gchmifft and nts annual spring tour.According hom in Box Butte county.Onem m m g ns g m ,'r11i¢¢5¢ to Professor G. J. Mulrnin, 1Choi1dBY» in the :econd week of Janu-
being absent,the motiozm ed Dn;ecoE, the _Qloir will this year qw. 48 cars of potatoes. mo-st of
E l 'rol urr
]'rlssumBlue Diamond Bnnd.Large
Rolls af 1000 Slleelu
1 m--.-29c
F L O U R
Safevuy's Family Blend All
Pnrpae Flour.Every Sack
Uncondlliomlly Gtnrnnleed
ta Satisfy
4a LB.SACK_______________99c
WITH
6 LBS.NAVY gEA_Ng___.___.SmPa n c a k e F l o u r
|uLLs 2,397~-'m '4 ;,...'::.'°° ma "°°°°::.'* ""' met- ~ '-as-=<=?»;---»f`-3 um ,'£f ww. lm ,;::,.a :.f:.::::°.::=E WM A $|_oolrackzs¢ °'
4 ,-" capu clues or Iowa Wivoting'AYE, the m°ti°7'|Minnesota.The cigoir
t- C E_*was Quilt for Duufs
sconain and pgintn in the southern Bmw; 'oi " n u n m n vo §|bus which |A.labauna,Louisiana.Texas and u .I n ul i ne x -
i t l l . :5
hm m m loufhs m Arhm u.k l n é é k i ~
_ , | | | , ' , | n d e q f k n w m h r m ~nto tluu Mu-I-Mum anna Pur~eCl_l;e
and Maple.H gallon canBy a Farrnu al Bedford, IowaCityClerkt o u r o f t w o y e a r s a g o
|_....\; \J. Harold Stewnrt,
liayor 'QI "ule ubeable' f m u u n to fur nin
f o r th e
rn voices-
EACH c
n n m y r
Safeway Whale
Wheat an Prnt D-an, in
Olr Q!! ovms LoAvr:s---_-___1.0¢
C H E E S E
»Crum Nebruh Dlllys
0 U N D - . _ - - - 1 ~
I~Aémulaénl b¢{»mmm for laumg Rm.
Satisfaction guaranteed or your money will beare sold by the Faihion ~ 1011. :mother bus was vurchuea W 'that *°n'i'~°l`Y.the choir yesSmxrtnewsdvmeeleinterday which mn ac-3 1 4 a n ll l d..J W 5 Silk mmodate tw -raDramas mined at $6.75 nm! rm 'nn § .. .n un .. ._ °£ * i ,. ,' f.. _ ~ § '.2 °f .-} f9 _ 2 ' f"
'e.§£e>:f;ef,,f£hsf"\°°v_.__.r "_._ ,___ ,_..,..."""1' ........... ........ "Q" wus wlvum --= vm: oummocuty being ship;--sizes I1 to 52 and 14% to 26%.th e tw o c o l l e g e ~from Box Butte county.In D
Fllhbll Center.8-It The Dum debate;¢ uzmmpmied Olllber 1 5 8 a n o f tr d n wrI|ww! md v»1»_g5.g¢¢u, vnmu br Prnt.in r. P°P¢l.§¢..Ph.1L>., »»m,l11im»d from ppinu anim A1i n up $1.50 new on ale at "du gg new of Crviniazm Univenity mee division of the Budington.
.. Ls.HI...A... na..a 14 ....;.|..-£--_»-.--
Z 5 c